SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04561
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 3.22
 

Sequence

CDS
ATGAGGACAGCCGGTTCTTTGAGCCGACTGCTCCCGAATATCGGGGGGCCGGATCAGGCTGTGCGCCGCCTCTACGCAGGGGTGGTGCGATCGATGGCCCTGTACGGTGCGCCTGTATGGGCTGAGCCACGCAACCGGGCCGCTATGGCTCGGTTCCTGCGCCGGCCGCAGCGCACCGTTGCTATCAGGGTCATCCGTGGATATCGCACCGTCTCCTTCGAGGCGGCGTGTGTGTTGGCGGGGACGCCGCCATGGGAGCTGGAGGCGGAGTCGCTCGCTGCCGACTATCGGTGGCGCAGCGAGCTTCGTGCTCTGGGCGTGGTGCGTCCCTCCAAAAGTGAGCTGCGGGCGCGGAAGGCCCATTCTCGGCGGTCCGTGCTCGAATCGTGGTCGAGGCGGTTGGCCAACCCCACGTGGGGTCTACGGACCGTTGAGGCGGTTTACCCAGTATTTGATGACTGGGTGAATCGTGGCCGAGGACGCCTCACCTTCCGTCTGGTGCAGGTGCTGACTGGGCACGGATGCTTCGGAAAGTATCTGCACCGGATAGGAGCTGAGCCGACGACGAGGTGCCACCATTGTGGACACGACCTGGACACGGCGGAACATACGCTCGCTGTCTGCCCCGCTTGGGAGGTGCAGCGCCGTGTCCTGGTCGCAAAGATAGGACCGGACTTGTCGCTGCCTGGCGTCGTGGCGTCGATGCTTGGCGGTGACGAGTCCTGGAAGGCTATGCTCGACTTCTGCGAGTGCACCATCTCGCAGAAGGAGGCGGCGGGGCGAGTGAGGCAAAGCTCTCCTCACTACGCAGAAACCCGCCGCCGCCGAGCAGGGGGTCGGGACCGGGGCCTCGTCCGTAACCCGGCCCCCTAA
Protein
MRTAGSLSRLLPNIGGPDQAVRRLYAGVVRSMALYGAPVWAEPRNRAAMARFLRRPQRTVAIRVIRGYRTVSFEAACVLAGTPPWELEAESLAADYRWRSELRALGVVRPSKSELRARKAHSRRSVLESWSRRLANPTWGLRTVEAVYPVFDDWVNRGRGRLTFRLVQVLTGHGCFGKYLHRIGAEPTTRCHHCGHDLDTAEHTLAVCPAWEVQRRVLVAKIGPDLSLPGVVASMLGGDESWKAMLDFCECTISQKEAAGRVRQSSPHYAETRRRRAGGRDRGLVRNPAP

Summary

EMBL
AB090825    BAC57926.1    AB126050    BAD86650.1    KZ150386    PZC71062.1    + More
KZ150308    PZC71477.1    KZ149950    PZC76665.1    KZ149896    PZC78733.1    AB078935    BAC06462.1    AB078930    BAC06454.1    AB078931    BAC06456.1    AB078929    BAC06452.1    LBMM01009501    KMQ88083.1    RSAL01000481    RVE41577.1    LBMM01012027    KMQ86470.1    LBMM01008861    KMQ88580.1    LBMM01009494    KMQ88097.1    D85594    BAA19776.1    LBMM01012957    LBMM01012956    KMQ85900.1    KMQ85901.1    LBMM01014132    KMQ85305.1    LBMM01003679    KMQ93242.1    LBMM01006538    KMQ90523.1    LBMM01006909    KMQ90209.1    ODYU01009945    SOQ54696.1    GL450953    EFN80213.1    KQ414641    KOC66782.1    QOIP01000009    RLU18544.1    KQ460685    KPJ12887.1    LBMM01008682    KMQ88705.1    LBMM01004272    KMQ92618.1    LBMM01006954    KMQ90166.1    LBMM01019838    KMQ83439.1    LBMM01005634    KMQ91349.1    LBMM01019839    KMQ83438.1    LBMM01024024    KMQ82631.1    QOIP01000031    RLU14697.1    QOIP01000010    RLU18098.1    LBMM01006657    KMQ90417.1    QOIP01000007    RLU20280.1    LBMM01006671    KMQ90407.1    LBMM01007036    KMQ90099.1    LBMM01008349    KMQ88951.1    LBMM01005216    KMQ91703.1    LBMM01015018    KMQ84954.1    LBMM01014909    KMQ85000.1    LBMM01004505    KMQ92346.1    LBMM01005733    KMQ91252.1    LBMM01015025    KMQ84953.1    LBMM01006110    KMQ90925.1    LBMM01011877    KMQ86578.1    ABLF02041886    LBMM01003245    KMQ93755.1    GGMR01006442    MBY19061.1    LBMM01012595    KMQ86127.1    RSAL01003504    RVE40273.1    GGMR01016864    MBY29483.1    GGMR01012534    MBY25153.1    LBMM01006725    KMQ90373.1    GGMR01011974    MBY24593.1    LBMM01006496    KMQ90570.1    LBMM01002480    KMQ94776.1    LBMM01004634    KMQ92224.1    LBMM01004697    KMQ92167.1    LBMM01014294    KMQ85237.1    ABLF02016435    ABLF02016436    ABLF02064751    GGMR01019609    MBY32228.1    LBMM01007425    KMQ89740.1    GGMR01015354    MBY27973.1    LBMM01020849    KMQ83202.1    LBMM01007659    KMQ89538.1    ABLF02023401    ABLF02029423    ABLF02060278    GFXV01001748    MBW13553.1    LBMM01002052    KMQ95336.1    LBMM01003988    KMQ92922.1    GL437417    EFN70484.1    CH963857    KRF98317.1    LBMM01006640    KMQ90440.1    LBMM01007162    KMQ89979.1    LBMM01005465    KMQ91492.1    ABLF02004674    ABLF02004675    ABLF02004676    ABLF02011637    LBMM01008278    KMQ89009.1    GGMR01012877    MBY25496.1    LBMM01012412    KMQ86235.1    GGMR01005740    MBY18359.1    LBMM01003941    KMQ92969.1    GGMR01006964    MBY19583.1    ABLF02012448    ABLF02012450    ABLF02012455    ABLF02012460    ABLF02004549    ABLF02058204    LBMM01014956    KMQ84982.1    LBMM01008422    KMQ88894.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF07776   zf-AD
PF00096   zf-C2H2
PF03372   Exo_endo_phos
PF17919   RT_RNaseH_2
PF01421   Reprolysin
PF13843   DDE_Tnp_1_7
PF05699   Dimer_Tnp_hAT
PF00098   zf-CCHC
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR041577   RT_RNaseH_2       
IPR024079   MetalloPept_cat_dom_sf       
IPR001590   Peptidase_M12B       
IPR029526   PGBD       
IPR037220   BED_dom       
IPR012337   RNaseH-like_sf       
IPR008906   HATC_C_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF57756   SSF57756       
SSF53098   SSF53098       
SSF140996   SSF140996       
Gene 3D

Ontologies

Topology

Length:
290
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.21313
Exp number, first 60 AAs:
0.19622
Total prob of N-in:
0.03474
outside
1  -  290
 
 

Population Genetic Test Statistics

Pi
198.182078
Theta
63.75616
Tajima's D
1.416083
CLR
0
CSRT
0.772461376931153
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号