SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04496
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.635
 

Sequence

CDS
ATGTATGGTTGCGAAACGTGGACCCTGAAAGAGGACACTACAAGACGCCTACAGGCATTCGAGATGTGGTGCTACCGTCGCATGTTACGCATTGGTTGGACGCAGAGGGTCAGGAACGAAACCGTGCTTCAGCGCGTTCATATGTCCCGGAAAATGCTGCCTGCTATCAAAAAGCGCAAGATAGAGTATCTCGGCCACGTGCTCAGGAACGATCGATACATGCTGCTCCAGCTGATAATTAGGGGCAAAGTGGACGGAAAGAGACGTGCTGGGCGAAGAAAGAAATCATGGCTCCGGAATATCCGGCAGTGGACCGGTATTGCCTCCGTCGAACAGCTGTTCCGGCTGGCTGCAGATAAAAACGAATATAGAAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MYGCETWTLKEDTTRRLQAFEMWCYRRMLRIGWTQRVRNETVLQRVHMSRKMLPAIKKRKIEYLGHVLRNDRYMLLQLIIRGKVDGKRRAGRRKKSWLRNIRQWTGIASVEQLFRLAADKNEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    KQ977522    KYN02133.1    + More
GDHC01017214    JAQ01415.1    GBRD01005612    JAG60209.1    GBHO01041897    JAG01707.1    GBHO01028834    JAG14770.1    LBMM01003995    KMQ92919.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    LBMM01001656    KMQ95932.1    NWSH01001998    PCG69477.1    ODYU01000306    SOQ34818.1    GGMS01004979    MBY74182.1    ABLF02012409    ABLF02012412    GGMR01005851    MBY18470.1    KZ149985    PZC75696.1    GGMR01013640    MBY26259.1    GGMS01008711    MBY77914.1    NWSH01000469    PCG76200.1    AFYH01119920    RQTK01000360    RUS81011.1    GGMS01001437    MBY70640.1    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    BART01031562    GAH15691.1    GGMR01016881    MBY29500.1    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    GGMR01016842    MBY29461.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    AAGJ04161766    KK852779    KDR16678.1    GBHO01034555    JAG09049.1    GGMR01018096    MBY30715.1    NCKU01012182    RWS00163.1    NCKU01008836    RWS01655.1    KK853131    KDR10935.1    GGMR01009131    MBY21750.1    HACG01049255    CEK96120.1    NEVH01002574    PNF41923.1    KK852941    KDR13536.1    HACG01049245    CEK96110.1    GGMS01006790    MBY75993.1    RQTK01000058    RUS89376.1    HACG01049249    CEK96114.1    KK852482    KDR22935.1    NCKU01004395    RWS06003.1    KK852811    KDR15914.1    KF881087    AIJ27486.1    NEVH01010478    PNF32508.1    NEVH01004403    PNF39833.1    KF881086    AIJ27485.1    RQTK01000357    RUS81065.1    KK853249    KDR09341.1    NEVH01009398    PNF33135.1    NEVH01023953    PNF17874.1    AHAT01022938    NEVH01025635    PNF15414.1    RQTK01000625    RUS76894.1    NEVH01017535    PNF24084.1    GBRD01015972    GBRD01015971    GBRD01015970    JAG49854.1    RQTK01000685    RUS76136.1    NEVH01008300    PNF34184.1    KK852843    KDR15156.1    NEVH01011876    PNF31501.1    NEVH01017534    PNF24114.1    GBHO01033031    GBHO01015473    GBHO01015472    GBHO01015471    GBHO01015469    GBHO01013134    GBHO01013133    GBHO01013129    GBHO01013128    JAG10573.1    JAG28131.1    JAG28132.1    JAG28133.1    JAG28135.1    JAG30470.1    JAG30471.1    JAG30475.1    JAG30476.1    AHAT01009145    NEVH01020940    PNF20497.1    MRZV01000221    PIK55282.1    GDHC01007098    GDHC01001590    JAQ11531.1    JAQ17039.1    NEVH01023958    PNF17737.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR036640   ABC1_TM_sf       
IPR000637   HMGI/Y_DNA-bd_CS       
SUPFAM
SSF56219   SSF56219        + More
SSF90123   SSF90123       
Gene 3D

Ontologies

Topology

Length:
132
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01739
Exp number, first 60 AAs:
0
Total prob of N-in:
0.31073
outside
1  -  132
 
 

Population Genetic Test Statistics

Pi
250.875097
Theta
145.997904
Tajima's D
2.182205
CLR
0
CSRT
0.907054647267637
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号