SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04403
Annotation
PREDICTED:_uncharacterized_protein_LOC106139819_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 1.863 Nuclear   Reliability : 1.8
 

Sequence

CDS
ATGCAGTCCGAAGCTACCGACGATGTGCTACTGGGAGGAACCTACCGTGTAGGAGTGAAGACGCCTAAGTTCAACCCCGAAGACCCAGAACTGTGGTTTGCTCAGCTGGAAGGGCAGTTCACCTTGTCCAATATAAACGCAGACGCCCACGGCCTCGCTTTAAAGAAAGCAGGAACTCAAGAAGTCGCTCACGTTCCCGTTCTCGTCCAAGCGATCATCCATACTGCTTCTTCCACTACCGCTTTGGAGAGCGAGCAAGAAGATGCACCCAGCCATGTACCTACCAGAAGGCGGGAAACTCCCAAGGCAGCCAATAGTGGCGGTTAA
Protein
MQSEATDDVLLGGTYRVGVKTPKFNPEDPELWFAQLEGQFTLSNINADAHGLALKKAGTQEVAHVPVLVQAIIHTASSTTALESEQEDAPSHVPTRRRETPKAANSGG

Summary

ProteinModelPortal

Ontologies

GO

Topology

Length:
108
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00725
Exp number, first 60 AAs:
0.00121
Total prob of N-in:
0.21797
outside
1  -  108
 
 

Population Genetic Test Statistics

Pi
63.485001
Theta
52.710812
Tajima's D
0.624708
CLR
0
CSRT
0.550572471376431
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号