SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04394
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.543 Nuclear   Reliability : 1.221
 

Sequence

CDS
ATGGTGCAAGAGAGACAATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCGAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGATAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTCTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATCGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAATTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCCAAGCGGTACTTGACACCTGGACAAAGACTTTTGCTCTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAGTACCAGCTTCTTCCATTTGACTCCATATAG
Protein
MVQERQSKLVSEVENSLGRVSEWGELNLVQFNPIKTQVCAFTAKKDPSVMAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYLTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSI

Summary

Cofactor
pyridoxal 5'-phosphate
EMBL
AY359886    AAQ57129.1    AB126052    BAD86652.1    RSAL01000487    RVE41561.1    + More
FM995623    CAX36787.1    RSAL01002067    RVE40593.1    RSAL01000002    RVE55041.1    RVE55094.1    RSAL01000422    RVE41792.1    RSAL01000171    RVE45150.1    RSAL01000090    RVE48098.1    RSAL01003136    RVE40332.1    RSAL01000028    RVE51880.1    ODYU01002162    SOQ39302.1    RSAL01000035    RVE51317.1    ODYU01007423    SOQ50184.1    RVE54942.1    RSAL01000164    RVE45343.1    RSAL01000380    RVE42061.1    AMCI01002135    EJX03495.1    GDRN01105059    JAI57791.1    ODYU01001348    SOQ37407.1    DPOC01000269    HCX22453.1    ODYU01000310    SOQ34825.1    HAAD01001474    CDG67706.1    RSAL01000095    RVE47834.1    LWDP01000391    ORD92879.1    RSAL01000193    RVE44603.1    GADI01001229    JAA72579.1    NSIT01000489    PJE77589.1    HAAD01000593    CDG66825.1    GANP01010944    JAB73524.1    GEGO01005479    JAR89925.1    GFAC01000919    JAT98269.1    GEFM01006250    JAP69546.1    ABJB010171673    DS626007    EEC00992.1    GEGO01004056    JAR91348.1    GDRN01111278    JAI56803.1    GGMR01016717    MBY29336.1    GDRN01111277    JAI56804.1    GEGO01007187    JAR88217.1    GBIH01002577    JAC92133.1    GEFM01002394    JAP73402.1    GFAA01004201    JAT99233.1    GEGO01001118    JAR94286.1    RSAL01000369    RVE42156.1    GBIH01002574    JAC92136.1    GECU01030313    JAS77393.1    GEFM01005882    JAP69914.1    GEGO01004433    JAR90971.1    FLMD02000280    SCV66640.1    GEFM01005904    JAP69892.1    GFAA01002794    JAU00641.1    GECU01009092    JAS98614.1    GFWV01002824    MAA27554.1    GEGO01002473    JAR92931.1    JXUM01073786    KQ562795    KXJ75115.1    RCHS01003332    RMX42564.1    GFAA01002514    JAU00921.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF00282   Pyridoxal_deC
PF04939   RRS1
PF10350   DUF2428
PF01873   eIF-5_eIF-2B
PF02182   SAD_SRA
PF00097   zf-C3HC4
PF08159   NUC153
PF03081   Exo70
PF00458   WHEP-TRS
PF02460   Patched
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR015424   PyrdxlP-dep_Trfase       
IPR002129   PyrdxlP-dep_de-COase       
IPR021115   Pyridoxal-P_BS       
IPR015421   PyrdxlP-dep_Trfase_major       
IPR015422   PyrdxlP-dep_Trfase_dom1       
IPR010977   Aromatic_deC       
IPR007023   Ribosom_reg       
IPR019442   DUF2428_death-receptor-like       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR039779   RFX-like       
IPR018957   Znf_C3HC4_RING-type       
IPR036987   SRA-YDG_sf       
IPR013083   Znf_RING/FYVE/PHD       
IPR017907   Znf_RING_CS       
IPR015947   PUA-like_sf       
IPR003105   SRA_YDG       
IPR001841   Znf_RING       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR016159   Cullin_repeat-like_dom_sf       
IPR004140   Exo70       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR030223   Dispatched       
IPR003392   Ptc/Disp       
IPR000731   SSD       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF53383   SSF53383       
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF88697   SSF88697       
SSF50978   SSF50978       
SSF74788   SSF74788       
SSF47060   SSF47060       

Ontologies

Topology

Subcellular location
Nucleus  
Length:
141
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00073
Exp number, first 60 AAs:
8e-05
Total prob of N-in:
0.28406
outside
1  -  141
 
 

Population Genetic Test Statistics

Pi
260.559076
Theta
143.204013
Tajima's D
2.57548
CLR
0.492911
CSRT
0.950502474876256
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号