SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04372
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.709
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATTGTTGCGGTTATGCGCCAATTCAAATTTTTAACATACTGAAAAATTTTAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACGTAAGCAGAAACTGTTGGCCCTTCAGATGGGGTTAAGCAGAACCACGGTGAAAAGGGTGTTAAATGAAGACTTAGGGTTTCGAGCATATCGAAGAAAAACAGGACATCGTTTGAATGCTCGTCTAATGGACCTGAGACTGAAGAGATGCCGCGCTTTGTTGAAGCGGTACGCGGGAAAAAAATACCGGGAAATTCTTTTTTCGGATGAAAAAAATTTTACCGTAGAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTATATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGACTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGTAA
Protein
MEWTLKEDRVAVIALHCCGYAPIQIFNILKNFNITKRFVYRTIKRYNEDSSVDDRSRSGRPRSVRTPAVIKAVKARIQRNPKRKQKLLALQMGLSRTTVKRVLNEDLGFRAYRRKTGHRLNARLMDLRLKRCRALLKRYAGKKYREILFSDEKNFTVEESYNKQNDKVYAHSSEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVYFCEKGVKTNAVVYTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIW

Summary

Similarity
Belongs to the TGF-beta family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    AB473770    BAH20555.1    RSAL01000133    RVE46339.1    RSAL01000022    RVE52367.1    RSAL01000063    RVE49524.1    RSAL01000012    RVE53510.1    JF779677    AEO90418.1    U47917    AAB47739.1    RSAL01000020    RVE52632.1    RSAL01000016    RVE53060.1    RSAL01000470    RVE41612.1    LNIX01000030    OXA41211.1    RSAL01000009    RVE53890.1    GGMS01016485    MBY85688.1    RSAL01000677    RVE41245.1    JARK01000176    EYC41234.1    JARK01001345    EYC27589.1    CAVP010059404    CDL95787.1    JARK01000059    EYC44525.1    KX931010    APL98300.1    UYSL01019905    VDL71189.1    DS268747    EFP00909.1    DS268492    EFP11689.1    PDUG01000005    PIC23776.1    DS268508    EFO83264.1    DS268421    EFO88618.1    PDUG01000006    PIC20538.1    DS268673    EFO98001.1    DS268466    EFP06959.1    DS268525    EFO85497.1    JARK01000255    EYC39473.1    JARK01001411    EYC06502.1    DS268545    EFO88382.1    UZAH01029309    VDP05368.1    UZAH01027257    VDO90094.1    PDUG01000012    PIC13506.1    PIC28734.1    HAAD01005865    CDG72097.1    DS268612    EFO94085.1    PDUG01000001    PIC51673.1    PDUG01000004    PIC32571.1    DS268679    EFO98285.1    JOJR01000583    RCN36166.1    JOJR01000015    RCN51257.1    DS268428    EFO94379.1    PIC32570.1    PIC29926.1    JARK01001658    EYB84158.1    JARK01001337    EYC34439.1    DS268606    EFO93488.1    UYSL01020440    VDL74616.1   
Pfam
PF00019   TGF_beta        + More
PF00005   ABC_tran
PF01061   ABC2_membrane
PF13358   DDE_3
PF00292   PAX
PF18397   IKBKB_SDD
PF00069   Pkinase
PF00250   Forkhead
PF10320   7TM_GPCR_Srsx
Interpro
IPR009057   Homeobox-like_sf        + More
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR013525   ABC_2_trans       
IPR027417   P-loop_NTPase       
IPR003439   ABC_transporter-like       
IPR017871   ABC_transporter_CS       
IPR036388   WH-like_DNA-bd_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR011009   Kinase-like_dom_sf       
IPR041185   IKBKB_SDD       
IPR029071   Ubiquitin-like_domsf       
IPR000719   Prot_kinase_dom       
IPR036390   WH_DNA-bd_sf       
IPR001766   Fork_head_dom       
IPR030456   TF_fork_head_CS_2       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
SUPFAM
SSF46689   SSF46689        + More
SSF57501   SSF57501       
SSF52540   SSF52540       
SSF56112   SSF56112       
SSF54236   SSF54236       
SSF46785   SSF46785       
Gene 3D
PDB
5CR4     E-value=3.78149e-07,     Score=128

Ontologies

Topology

Subcellular location
Secreted  
Nucleus  
Length:
287
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
16.21209
Exp number, first 60 AAs:
13.8513
Total prob of N-in:
0.14561
POSSIBLE N-term signal
sequence
outside
1  -  287
 
 

Population Genetic Test Statistics

Pi
144.651795
Theta
63.652269
Tajima's D
2.36063
CLR
0.444084
CSRT
0.930153492325384
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号