SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04354
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.896
 

Sequence

CDS
ATGGTCAGGAACGACAGGCTCTCTGCTCGTGGTGGTGGTACCGTCATTTACTATAGAAGAGCCCTGCATTGCGTCCCGCTCGATCCTCCCGCGCTCGCTAATATCGAAGCATCAGTGTGCCGAATCTCACTGACGGGACACGCGCCGATCGTTATCGCGTCCGTTTATCTTCCACCGGATAAGATCGTTCTAAGCAGTGATATCGAGGCGCTGCTCGGCATGGGGAGCTCTGTCATTCTGGCGGGCGACCTAAATTGTAAACACATCAGGTGGAACTCACACACCACAACCCCGAATGGCAGGCGGCTTGACGCGTTAGTCGATGATCTCGCCTTCGATATCGTCGCTCCGCTAACACCGACTCACTACCCGCTAAATATCGCGCATCGCCCGGATATACTTGACATAGCGTTATTAAAAAACGTAACTCTGAGCTTACACTCGATCGAAGTAGTTTCAGAGTTAGATTCAGACCACCGTCCCGTCGTTATGAAGCTCGGTCGCGCTCCCGACTCCGTTCCCGTCACGAGGACTGTGGTGGATTGGCACACGCTGGGCATCAGCCTGGCTGAATCTGATCCACCATCGCTCCCGTTTAACCCGGACTCTACCCCGTCTCTTCAGGATACCGCTGAAGCCATAGACATTTTAACGTCACACATCACCTCAACATTAGATAGATCATCGAAACAAGTTGTAGCGGAGGACTTCCTTCACCGCTTCAAATTGTCCGATGATATTAGGGAACTCCTTAGAGCTAAGAACGCCTCGATACGCGCCTACGACAGGTATCCTACCGCGGAAAATCGTATTCGAATGCGTGCCCTACAACGCGACGTAAAGTCTCGCATCGCCGAAGTCCGAGATGCCAGATGGTCTGATTTCTTAGAAGGACTCGCGCCCTCCCAAAGGTCTTACTACCGCTTAGCTCGTACTCTCAAATCGGATACGGTAGTAACTATGCCCCCCCTCGTAGGCCCCTCAGGCCGACTCGCGGCGTTTGATGATGACGAAAAAGCAGAGTTGCTGGCCGATACATTGCAAACCCAGTGCACCCCCAGCACTCAATCCGTGGACCCTGTTCATGTAGAATTAGTAGACAGTGAGTTAAAGACTTGA
Protein
MVRNDRLSARGGGTVIYYRRALHCVPLDPPALANIEASVCRISLTGHAPIVIASVYLPPDKIVLSSDIEALLGMGSSVILAGDLNCKHIRWNSHTTTPNGRRLDALVDDLAFDIVAPLTPTHYPLNIAHRPDILDIALLKNVTLSLHSIEVVSELDSDHRPVVMKLGRAPDSVPVTRTVVDWHTLGISLAESDPPSLPFNPDSTPSLQDTAEAIDILTSHITSTLDRSSKQVVAEDFLHRFKLSDDIRELLRAKNASIRAYDRYPTAENRIRMRALQRDVKSRIAEVRDARWSDFLEGLAPSQRSYYRLARTLKSDTVVTMPPLVGPSGRLAAFDDDEKAELLADTLQTQCTPSTQSVDPVHVELVDSELKT

Summary

Subunit
The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.
Similarity
Belongs to the histone H2A family.
EMBL
U07847    AAA17752.1    AB055391    BAB21761.1    AB018558    BAA76304.1    + More
KQ459265    KPJ02064.1    AF081103    AAC72921.1    GEZM01008457    JAV94772.1    KB632143    ERL89075.1    GEBQ01004157    JAT35820.1    ABLF02008153    ABLF02008462    ABLF02008464    ABLF02012584    ABLF02013765    ABLF02024884    KQ973342    KXZ75569.1    GGMR01012189    MBY24808.1    GGMS01012398    MBY81601.1    ABLF02036316    ABLF02036319    ABLF02048663    ABLF02066977    GBBI01004395    JAC14317.1    GGMR01004661    MBY17280.1    KK115285    KFM64681.1    GALX01005299    JAB63167.1    KK118005    KFM71947.1    LBMM01018021    KMQ83899.1    ABLF02025082    ABLF02039175    ABLF02041809    ABLF02022418    KK113281    KFM59799.1    ABLF02010814    ABLF02010815    ABLF02037860    ABLF02037869    ABLF02003241    ABLF02003242    ABLF02025904    GEZM01021868    JAV88847.1    GGMS01006359    MBY75562.1    ABLF02065839    GEBQ01003077    JAT36900.1    ACPB03027378    KQ971729    KYB24751.1    GFTR01008279    JAW08147.1    ABLF02041767    GFTR01008262    JAW08164.1    ABLF02014934    ABLF02014939    ABLF02017810    GGMS01010725    MBY79928.1    GGMR01018716    MBY31335.1    ABLF02009591    ABLF02009592    ABLF02009594    ABLF02066703    NEVH01023280    PNF18085.1    JTDY01005246    KOB67202.1    ABLF02015631    ABLF02021986    ABLF02021987    ABLF02021991    ABLF02023911    ABLF02034467    ABLF02042518    ABLF02057746    KK119261    KFM75202.1    GBGD01000415    JAC88474.1    GEZM01099921    GEZM01099920    GEZM01099918    GEZM01099906    JAV53125.1    GGMR01000226    MBY12845.1    ABLF02028535    ABLF02028545    GGMR01016297    MBY28916.1    GFTR01008271    JAW08155.1    GALX01005359    JAB63107.1    ABLF02042385    ABLF02043963    GFTR01008260    JAW08166.1    GEDC01029594    JAS07704.1    GGMR01015412    MBY28031.1    ABLF02066437    KB632327    ERL92508.1    GFTR01008261    JAW08165.1    GFXV01000908    MBW12713.1    M17214    AAA28508.1    ABLF02037715    KK119692    KFM76444.1    GGMS01006655    MBY75858.1    KK119069    KFM74603.1    MCIT02004487    PHT96476.1    LBMM01015125    KMQ84919.1    NEVH01009134    PNF33528.1    NEVH01011985    PNF31054.1    NEVH01027074    PNF13841.1    GGMR01012443    MBY25062.1    NEVH01006736    PNF36716.1    JTDY01002082    KOB72150.1    NEVH01005277    PNF39135.1    JTDY01011738    KOB53653.1    JTDY01003188    KOB69997.1    GGMR01001088    MBY13707.1    KK119923    KFM77079.1    NEVH01005923    PNF38085.1    GGMS01000479    MBY69682.1    GEZM01021881    JAV88842.1    ABLF02003895    ABLF02006045    ABLF02035991    ABLF02066257    ABLF02023551    ABLF02023561    NWSH01007753    PCG62823.1    JTDY01000526    KOB76804.1    GGMS01001094    MBY70297.1    NEVH01021205    PNF19912.1    GGMR01002322    MBY14941.1    GFTR01008257    JAW08169.1    NEVH01017470    PNF24199.1    NEVH01016302    PNF25823.1    LBMM01014024    KMQ85369.1    GFTR01008038    JAW08388.1    GBBI01003747    JAC14965.1    GGMS01002992    MBY72195.1    GBBI01004571    JAC14141.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF14291   DUF4371
PF07530   PRE_C2HC
PF05699   Dimer_Tnp_hAT
PF07727   RVT_2
PF03372   Exo_endo_phos
PF03564   DUF1759
PF18701   DUF5641
PF00665   rve
PF05380   Peptidase_A17
PF17921   Integrase_H2C2
PF05585   DUF1758
PF16211   Histone_H2A_C
PF00125   Histone
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR025398   DUF4371       
IPR006579   Pre_C2HC_dom       
IPR012337   RNaseH-like_sf       
IPR008906   HATC_C_dom       
IPR006580   Znf_TTF       
IPR013103   RVT_2       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR005312   DUF1759       
IPR040676   DUF5641       
IPR008737   Peptidase_asp_put       
IPR008042   Retrotrans_Pao       
IPR001584   Integrase_cat-core       
IPR032458   Histone_H2A_CS       
IPR002119   Histone_H2A       
IPR032454   Histone_H2A_C       
IPR007125   Histone_H2A/H2B/H3       
IPR009072   Histone-fold       
IPR020847   AP_endonuclease_F1_BS       
SUPFAM
SSF56219   SSF56219        + More
SSF53098   SSF53098       
SSF47113   SSF47113       
Gene 3D

Ontologies

Topology

Subcellular location
Chromosome  
Nucleus  
Length:
372
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0742199999999999
Exp number, first 60 AAs:
0.05439
Total prob of N-in:
0.04733
outside
1  -  372
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0.59593
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号