SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04340
Annotation
PREDICTED:_uncharacterized_protein_LOC106717302_[Papilio_machaon]
Location in the cell
Nuclear   Reliability : 3.129
 

Sequence

CDS
ATGGAGATGGTAAATGTTACCCACAAAAAAGACCAACCGCAGAAAAAAGCCTTAGTTAAAAATTATACAACCCAAAAACCCACAAATTTGAAGTCATTTGTCACAGAAGTAAGCAGCAAATGCACTTATTGCTCACAAAACCATTATATTTGTCACTGTAAAGAATTCACCGCATTAGATGTTCCTCAACGTCAGGATTTTATTAAGAAGAATGGCATTTGTTTTAATTGCCTTGTAAAAGGTCACTCCGTTAATGCGTGTAGGCAGAGCACCACCTGTAGAAAATGTTGTCGACGACATCACACTCTGTTGCACTTCACAAACCCTAACAAGACCACAGCAGTGCCGGAAAGCGATGCAGCAACACCCAGTACACCTGAAACAAGCCAACCCAGATCAACCGTCGTTTACAAGGCTGAGGTTGACAAAGACAGTGAGGAAGTATTATTGGCAACCGCACGAATTGCAGTTAAGTCGAGGAACGGCGACACGATAATCTTGAGAGCACTGATTGATCCGTGCTCGCAATCAAACTTTGTTACTGAAGCGGCAGCTCAACTGCTTAATCTCGAGCGCACTTCAATCAGCGGAAAAATTACTGGCATATCATCTATACCGCTGACCACCAAGTCACAAGTTACGTTGAACTTTCATGCTATAAGAAATTCATCACACATGATCACAGCTAAGGCGTACGTCCTTAGACGAATAAATTCGAGATTACCATCACAAGAGCTCCCATCAGATACCTGGCCTTCTTCTGAGATTTCGGATCTTGCGGATCCACACTTTCACAAGCCAGGATCTATCGACGTGCTATTAGGTGCAGTTGTATATGCGCATATTATTCTTGACGGAATAATAAAACGCAATGAGTCTCTGGTCGCTTTGAACTCAAGATTGGGATGGCTGGTAAGCGGCGAAGTTGCGCAGTCTGGCCATCAGTCACATAATGTAGTTGTTATGCACACACAAGTCGAAGTTGATCAGTTGCTACGTCAATTTTGGGAGATTGATGAATATTCACCAAACGTGAAGCCTCTGTCAAAACTTGAAATGCAGTGTGAAGAGCATTTTAAGAAAACTCACACTCGAAACACTGGCTGTCGATATGAGGTTCGCCTACCCTTCAAGGACGAAGACGCTCCAAATTTAGGCAACTCCAGACAACTTGCTTTGAAACGCTTACATCAGATGGAAAATAAGTTTAAGCGAAGACCCGAGTTTCACGAAGAATACAGTAAGTTCATGAGACAATATGAGTCACTCGGTCATATGGAGGTCGTCCCTGAAACAGAGAAGATGAATAGAGCTTATTACCTACCACATCATGCTATTCTTCGTGCCTCGAGCCTCACTACAAAGTTGCGCGTAGTTTTGACGGAAGCGCTAAGCCTGTAG
Protein
MEMVNVTHKKDQPQKKALVKNYTTQKPTNLKSFVTEVSSKCTYCSQNHYICHCKEFTALDVPQRQDFIKKNGICFNCLVKGHSVNACRQSTTCRKCCRRHHTLLHFTNPNKTTAVPESDAATPSTPETSQPRSTVVYKAEVDKDSEEVLLATARIAVKSRNGDTIILRALIDPCSQSNFVTEAAAQLLNLERTSISGKITGISSIPLTTKSQVTLNFHAIRNSSHMITAKAYVLRRINSRLPSQELPSDTWPSSEISDLADPHFHKPGSIDVLLGAVVYAHIILDGIIKRNESLVALNSRLGWLVSGEVAQSGHQSHNVVVMHTQVEVDQLLRQFWEIDEYSPNVKPLSKLEMQCEEHFKKTHTRNTGCRYEVRLPFKDEDAPNLGNSRQLALKRLHQMENKFKRRPEFHEEYSKFMRQYESLGHMEVVPETEKMNRAYYLPHHAILRASSLTTKLRVVLTEALSL

Summary

Similarity
Belongs to the synaptobrevin family.
EMBL
ODYU01002449    SOQ39955.1    KQ458473    KPJ05885.1    KK114194    KFM61875.1    + More
ODYU01008608    SOQ52337.1    ODYU01008829    SOQ52773.1    KQ460036    KPJ18393.1    RSAL01000327    RVE42512.1    AJVK01036816    KQ977557    KYN02013.1    LBMM01016966    KMQ84252.1    LBMM01007859    KMQ89359.1    LBMM01011051    KMQ87060.1    LBMM01008464    KMQ88855.1    LJIJ01005839    ODM87229.1    LBMM01011423    KMQ86851.1    KQ461175    KPJ07794.1    GEZM01060253    JAV71158.1    KQ977526    KYN02131.1    GEZM01060254    JAV71154.1    LBMM01015575    KMQ84755.1    LBMM01010986    KMQ87097.1    LNIX01000005    OXA53452.1    LBMM01015603    KMQ84743.1    GEHC01000865    JAV46780.1    JTDY01001518    KOB73672.1    LNIX01000002    OXA59522.1    LBMM01008324    KMQ88972.1    QOIP01000004    RLU24048.1    GAKP01007887    JAC51065.1    GEZM01066274    JAV68017.1    JTDY01000554    KOB76692.1    LBMM01010417    KMQ87475.1    GEZM01066272    JAV68024.1    GAMC01003146    JAC03410.1    JTDY01004853    KOB67675.1    LBMM01016204    KMQ84502.1    QOIP01000012    RLU16284.1    RLU15928.1    GEZM01012999    JAV92824.1    KQ979018    KYN24375.1    KZ149908    PZC78210.1    LBMM01012238    KMQ86334.1    LBMM01012568    KMQ86144.1    LBMM01016480    KMQ84410.1    LBMM01009202    KMQ88311.1    GALX01002428    JAB66038.1    U11691    AAA19905.1    JTDY01002583    KOB71156.1    LNIX01000026    OXA42254.1    QOIP01000008    RLU19576.1    ABLF02028666    ABLF02066713    KQ978502    KYM93417.1    GEHC01000946    JAV46699.1    GEZM01078370    GEZM01078366    GEZM01078363    JAV62757.1    QOIP01000013    RLU15366.1    KK111555    EZA46362.1    NWSH01000070    PCG79985.1    GGFM01007542    MBW28293.1    CR954257    CAJ14165.1    ABLF02041863    QOIP01000009    RLU19024.1    JTDY01014017    KOB52061.1    AY180917    AAN87269.1    ABLF02012239    ABLF02012241    ABLF02017372    ABLF02042178    ABLF02066436    JTDY01001331    KOB74176.1    GDHF01025509    GDHF01017777    JAI26805.1    JAI34537.1    GGMR01017803    MBY30422.1    GGMR01002340    MBY14959.1    QOIP01000005    RLU22365.1    ABLF02039606    LBMM01008872    KMQ88568.1    LNIX01000036    OXA39969.1    LBMM01009284    KMQ88248.1    RSAL01000392    RVE41994.1    ABLF02041590    QOIP01000002    RLU25685.1    ABLF02005684    HACL01000129    CFW94423.1    KQ981002    KYN10407.1    ABLF02035780    AJWK01000239    AJWK01000240    LBMM01017223    KMQ84153.1    LBMM01016077    KMQ84566.1    LBMM01009898    KMQ87805.1    LBMM01009746    KMQ87900.1    GGMR01017890    MBY30509.1    RLU15613.1    GGFJ01000337    MBW49478.1    KQ414700    KOC63377.1    GALX01005110    JAB63356.1    GANO01004788    JAB55083.1    GBHO01005506    GBHO01005503    JAG38098.1    JAG38101.1    GFTR01008874    JAW07552.1    LBMM01009688    KMQ87939.1    GALX01004875    JAB63591.1    ABLF02008594    AJ487856    CAD32253.1    LBMM01009403    KMQ88163.1   
Pfam
PF05585   DUF1758        + More
PF18701   DUF5641
PF05380   Peptidase_A17
PF03564   DUF1759
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
PF17917   RT_RNaseH
PF00078   RVT_1
PF00008   EGF
PF13843   DDE_Tnp_1_7
PF00665   rve
PF00230   MIP
PF12259   Baculo_F
PF13774   Longin
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR008737   Peptidase_asp_put       
IPR040676   DUF5641       
IPR005312   DUF1759       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR001584   Integrase_cat-core       
IPR008042   Retrotrans_Pao       
IPR012337   RNaseH-like_sf       
IPR000477   RT_dom       
IPR041373   RT_RNaseH       
IPR001969   Aspartic_peptidase_AS       
IPR041577   RT_RNaseH_2       
IPR001878   Znf_CCHC       
IPR000253   FHA_dom       
IPR000742   EGF-like_dom       
IPR011042   6-blade_b-propeller_TolB-like       
IPR013032   EGF-like_CS       
IPR000033   LDLR_classB_rpt       
IPR001995   Peptidase_A2_cat       
IPR029526   PGBD       
IPR036875   Znf_CCHC_sf       
IPR000425   MIP       
IPR023271   Aquaporin-like       
IPR022048   Envelope_fusion-like       
IPR011012   Longin-like_dom_sf       
IPR010908   Longin_dom       
IPR000727   T_SNARE_dom       
SUPFAM
SSF53098   SSF53098        + More
SSF50630   SSF50630       
SSF57756   SSF57756       
SSF81338   SSF81338       
SSF64356   SSF64356       

Ontologies

Topology

Length:
466
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.03608
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01477
outside
1  -  466
 
 

Population Genetic Test Statistics

Pi
255.379064
Theta
186.967106
Tajima's D
1.774073
CLR
0
CSRT
0.846357682115894
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号