SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04336
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.687
 

Sequence

CDS
ATGTGGTTCCACAGGCCCCGGAGAGTGCCACCTGTCGATGCCCATATCGTGGTTGGAGGCGTCCGTATTGGGGTCGGGGTGCAGTTGAAGTACCTTGGCCTCATTCTGGACAGTCGTTGGACCTTCCGTGCTCACTTTCAGAACCTGGTCCCTCGTTTGTTGGCCGGCGCGTTAAGCCGGCTCCTTCCCAACGTCGGTGGGCCTGACCAGGTGACGCGCCGTCTCTATACAGGGGTGATGCGATCAATGGCCTTATACGGGGCGCACGTGTGGGGCCAGTCCCTGGCCGTGGGGGTAGCGAAGCTGCTGCAACGGCCGCAACGCACCATCGCGGTCAGGGTCATCCGCGGCTATCGCACCATCTCCTTTGAGGCGGCATGTGTACTGGCTGGGACGCCGCCTTGGGTTCTGGAAGCGGAGGCGCTCGCCGCTGACTATCAGTGGCGGGCTGACCTTCGTGGCCGGGGCGTGGCACGTCCCAGCCCCAGTGTGGTCAGAGCGCGGAGGGCCCAATCTCGGCGGTCCGTGCTGGAGTCATGGTCCAGACGGCTGGCCGATCCTTCGGCTGGTCGTAGGACCGTCGAGGCGATTCGCCCGGTTCTTGTGAATTGGGTGAATCGTGACAGAGGACGCCTCACTTTACGGCTCACGCAGGTGCTCACTGGGCATGGTTGCTTCGGTGAGTTCCTGCACCGGATCGGAGCCGAGCCGATGGCAGAGTGCCACCATTGTGGTTGCGACTTGGACACGGTGGAGCACACGCTCGTCGCCTGCCCTGCATGGAAGGGGTGGCGCCGTGTCCTCGTCGCAAAAATAGGAAACGACTTGTCGTTGCCGGGTGTTGTGGCATCGATGCTCGGTGACGACGAGTCGTGGAAGGCGATGCTCGACTTCTGCAAGTGCACCATCTCGCAGAAGGAGGCGGCGGAGCGCGTGAGAGACGCGCAGGCCCGCCGCCGTCGAGCGGGGGTCAGGGAGGCGGATTTCGCCCAAGCCCTGGCCCTCTAA
Protein
MWFHRPRRVPPVDAHIVVGGVRIGVGVQLKYLGLILDSRWTFRAHFQNLVPRLLAGALSRLLPNVGGPDQVTRRLYTGVMRSMALYGAHVWGQSLAVGVAKLLQRPQRTIAVRVIRGYRTISFEAACVLAGTPPWVLEAEALAADYQWRADLRGRGVARPSPSVVRARRAQSRRSVLESWSRRLADPSAGRRTVEAIRPVLVNWVNRDRGRLTLRLTQVLTGHGCFGEFLHRIGAEPMAECHHCGCDLDTVEHTLVACPAWKGWRRVLVAKIGNDLSLPGVVASMLGDDESWKAMLDFCKCTISQKEAAERVRDAQARRRRAGVREADFAQALAL

Summary

EMBL
AB090825    BAC57926.1    AB126050    BAD86650.1    KZ150386    PZC71062.1    + More
AB078935    BAC06462.1    AB078931    BAC06456.1    AB078930    BAC06454.1    KZ149896    PZC78733.1    KZ150308    PZC71477.1    AB078929    BAC06452.1    KZ149950    PZC76665.1    D85594    BAA19776.1    RSAL01000481    RVE41577.1    LBMM01012027    KMQ86470.1    LBMM01008861    KMQ88580.1    LBMM01009494    KMQ88097.1    LBMM01014132    KMQ85305.1    GL450953    EFN80213.1    LBMM01005707    KMQ91279.1    LBMM01006671    KMQ90407.1    LBMM01006657    KMQ90417.1    LBMM01006954    KMQ90166.1    LBMM01003679    KMQ93242.1    KQ414641    KOC66782.1    LBMM01008682    KMQ88705.1    LBMM01019839    KMQ83438.1    LBMM01005733    KMQ91252.1    LBMM01005634    KMQ91349.1    LBMM01019838    KMQ83439.1    QOIP01000010    RLU18098.1    LBMM01004272    KMQ92618.1    LBMM01002052    KMQ95336.1    QOIP01000031    RLU14697.1    LBMM01007036    KMQ90099.1    LBMM01006909    KMQ90209.1    QOIP01000007    RLU20280.1    LBMM01004634    KMQ92224.1    LBMM01008349    KMQ88951.1    LBMM01006063    KMQ90967.1    LBMM01006110    KMQ90925.1    LBMM01006725    KMQ90373.1    GGMR01016864    MBY29483.1    LBMM01020849    KMQ83202.1    LBMM01015018    KMQ84954.1    LBMM01005216    KMQ91703.1    LBMM01015025    KMQ84953.1    GGMR01011974    MBY24593.1    LBMM01003988    KMQ92922.1    LBMM01005948    KMQ91066.1    LBMM01004505    KMQ92346.1    LBMM01007425    KMQ89740.1    LBMM01009738    KMQ87908.1    LBMM01002480    KMQ94776.1    LBMM01003245    KMQ93755.1    LBMM01014909    KMQ85000.1    LBMM01007659    KMQ89538.1    LBMM01021647    KMQ83033.1    ABLF02005203    ABLF02041316    GGMR01006442    MBY19061.1    GGMR01019609    MBY32228.1    GGMR01015354    MBY27973.1    GGMR01014918    MBY27537.1    ABLF02041886    LBMM01014956    KMQ84982.1    GFXV01001748    MBW13553.1    LBMM01012595    KMQ86127.1    LBMM01008422    KMQ88894.1    ABLF02011238    LBMM01004697    KMQ92167.1    ABLF02015311    ABLF02015320    ABLF02034009    ABLF02043484    GGMR01012534    MBY25153.1    ABLF02004597    ABLF02041324    LBMM01012412    KMQ86235.1    ABLF02017307    ABLF02013380    ABLF02013382    ABLF02004854    ABLF02041317    GGMS01012744    MBY81947.1    GGMR01012877    MBY25496.1    LBMM01014122    KMQ85315.1    GFXV01003903    MBW15708.1    KQ972691    KXZ75805.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF03372   Exo_endo_phos
PF07776   zf-AD
PF00096   zf-C2H2
PF17919   RT_RNaseH_2
PF00098   zf-CCHC
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR041577   RT_RNaseH_2       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF57756   SSF57756       
Gene 3D

Ontologies

Topology

Length:
335
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.17669
Exp number, first 60 AAs:
0.3238
Total prob of N-in:
0.05696
outside
1  -  335
 
 

Population Genetic Test Statistics

Pi
67.418028
Theta
37.088635
Tajima's D
2.191791
CLR
0.408749
CSRT
0.912154392280386
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号