SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04319
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.35
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTCAAAAATTTGAATATACCCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAGTTCAAAGAAATCCCAAACATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGACTGTATTCAAAATCACGGAGGTCATTTTGAATAAACTTTAG
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKNLNIPKRFVYRTIKRYNEDSSVDDRSRSGRPRSVRTPAVIKAVKARVQRNPKHSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKTVFKITEVILNKL

Summary

Pfam
PF13358   DDE_3
Interpro
IPR009057   Homeobox-like_sf        + More
IPR038717   Tc1-like_DDE_dom       
SUPFAM
SSF46689   SSF46689       
PDB
5CR4     E-value=0.000119523,     Score=104

Ontologies

Topology

Length:
184
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.97968
Exp number, first 60 AAs:
0.97968
Total prob of N-in:
0.18933
outside
1  -  184
 
 

Population Genetic Test Statistics

Pi
148.059345
Theta
76.616369
Tajima's D
2.039393
CLR
0
CSRT
0.889355532223389
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号