SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04305
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC105841899?_partial_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.768 PlasmaMembrane   Reliability : 1.687
 

Sequence

CDS
ATGCTTAACTATTCTGTGCGGACGGCGATACCGGTTCCCGGTCCCCGGTTCCCGGTCGTGCGCGGTGTTCCACAGGGGTCGGTGCTCGGCCCCCTTTTGTGGAATATCGGGTATGACTGGGTGCTGAGAGATGCCCTCCTCCCGGGCCTGAGCGTAATCTGTTACGCGGACGACACGTTGGTCGTGGCCCGGGGGGGAATTTTGCTGAGTCTTGCTACGGCTGGGGTGGCGCATGTCGTCGGCAAAATCAGGAGATTGGGCCTCGACGTGGCGCTGAGTAAATCCGAGGTCATGTGGTTCCACAGGCCCCGGAGAGTGCCACCTGTCGATGCCCATATCGTGGTTGGAGGCGTCCGTATCGGGGTCGGGGTGCAGTTGAAGTACCTCGGCCTCATTCTGGACAGTCGTTGGACCTTCCGTGCTCACTTTCAGAACCTGGTCCCTCGTTTGTTGGGGGTGGCCGGCGCGTTAAGCCGGCTTCTGCCCAACGTCGGGGGGCCTGACCAGGTGACGCGCCGTCTTTATACGGGGATGGTGCGATCAATGGCCCTATACGGGGCGCCCGTGTGGGGCCAGTCCCTGGCCGTGAGTGTGGCGAAGCTGCTGCAACGGCCGCAACGCACCATCGCGGTCAGCGTCATCCGTGGTTATCGCACCATCTCCTTTGAGGCGGCGTGTGTACTGGCTGGGACGCCACCTTGGGTTCTGGAAGCGGAGGCGCTCGCCGCTGACTATAAGTGGCGGGCTGACCTTCGTTCCCGAGGCGTGGCGCGTCCCAGCCCCAGTGTGGTCAGAGCGCGGAGGGCCCAATCTCAGCGGTCCGTGCTGGAGTTATGGTCCAAGCGGCTGGCTAATCCTTCGGCTGGTCGTAAGACCGTCGAGGCGATTCGCCCGGTTCTTGTGGATTGGGTGAATCGTGACAAAGGACGCCTCACTTTCCGGCTCACGCAGGTGTTCACTGGGAATGGTCTTTCGTTCAACTCTGACATACCCCGCCCAGTATTTTCACTCTGTCGTAATGATGCATTTGGGTTTGCAAAAGAAAAACAGTACTACAATACTTTTACGCCGGTAAGAGTAACGCCATCTATCGCCGAATAG
Protein
MLNYSVRTAIPVPGPRFPVVRGVPQGSVLGPLLWNIGYDWVLRDALLPGLSVICYADDTLVVARGGILLSLATAGVAHVVGKIRRLGLDVALSKSEVMWFHRPRRVPPVDAHIVVGGVRIGVGVQLKYLGLILDSRWTFRAHFQNLVPRLLGVAGALSRLLPNVGGPDQVTRRLYTGMVRSMALYGAPVWGQSLAVSVAKLLQRPQRTIAVSVIRGYRTISFEAACVLAGTPPWVLEAEALAADYKWRADLRSRGVARPSPSVVRARRAQSQRSVLELWSKRLANPSAGRKTVEAIRPVLVDWVNRDKGRLTFRLTQVFTGNGLSFNSDIPRPVFSLCRNDAFGFAKEKQYYNTFTPVRVTPSIAE

Summary

Similarity
Belongs to the AB hydrolase superfamily. Lipase family.
EMBL
AB090825    BAC57926.1    KZ150386    PZC71062.1    AB078930    BAC06454.1    + More
AB078931    BAC06456.1    AB078929    BAC06452.1    AB078935    BAC06462.1    LBMM01024882    KMQ82501.1    KZ149896    PZC78733.1    D85594    BAA19776.1    RSAL01000481    RVE41577.1    LBMM01024063    KMQ82623.1    LBMM01012027    KMQ86470.1    KQ460685    KPJ12887.1    LBMM01006063    KMQ90967.1    LBMM01009738    KMQ87908.1    LBMM01019839    KMQ83438.1    LBMM01006954    KMQ90166.1    LBMM01006671    KMQ90407.1    LBMM01005707    KMQ91279.1    LBMM01019838    KMQ83439.1    LBMM01002052    KMQ95336.1    LBMM01004272    KMQ92618.1    LBMM01008448    KMQ88867.1    LBMM01008682    KMQ88705.1    LBMM01006657    KMQ90417.1    LBMM01005733    KMQ91252.1    LBMM01004634    KMQ92224.1    LBMM01021647    KMQ83033.1    LBMM01013668    KMQ85535.1    LBMM01003575    KMQ93366.1    LBMM01007036    KMQ90099.1    LBMM01003302    KMQ93689.1    LBMM01006725    KMQ90373.1    LBMM01004262    KMQ92649.1    LBMM01004261    KMQ92650.1    LBMM01014132    KMQ85305.1    LBMM01007425    KMQ89740.1    GGMR01000779    MBY13398.1    LBMM01003245    KMQ93755.1    LBMM01008422    KMQ88894.1    LBMM01015025    KMQ84953.1    LBMM01007659    KMQ89538.1    QOIP01000010    RLU18098.1    LBMM01006496    KMQ90570.1    QOIP01000031    RLU14697.1    LBMM01003988    KMQ92922.1    LBMM01015018    KMQ84954.1    LBMM01004505    KMQ92346.1    LBMM01004697    KMQ92167.1    LBMM01009527    LBMM01009515    KMQ88059.1    KMQ88067.1    LBMM01004138    KMQ92774.1    LBMM01015285    KMQ84870.1    LBMM01014122    KMQ85315.1    LBMM01005465    KMQ91492.1    GGMR01014195    MBY26814.1    LBMM01002480    KMQ94776.1    LBMM01005216    KMQ91703.1    GBHO01002982    JAG40622.1    LBMM01014956    KMQ84982.1    LBMM01005474    KMQ91485.1    GECU01032129    JAS75577.1    GGMR01015159    MBY27778.1    KMQ94772.1    GGMR01016764    MBY29383.1    LBMM01005845    KMQ91162.1    GGMR01015354    MBY27973.1    ABLF02005203    ABLF02041316    LBMM01012322    LBMM01012138    KMQ86282.1    KMQ86387.1    ABLF02011238    ABLF02015311    ABLF02015320    ABLF02034009    ABLF02043484    LBMM01012412    KMQ86235.1    LBMM01008278    KMQ89009.1    GBXI01013438    JAD00854.1    QOIP01000014    RLU15074.1    GFXV01001748    MBW13553.1    GGMR01006838    MBY19457.1    KU543679    AMS38363.1    KQ972691    KXZ75805.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF03372   Exo_endo_phos
PF07776   zf-AD
PF00096   zf-C2H2
PF00098   zf-CCHC
PF00151   Lipase
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR029058   AB_hydrolase       
IPR013818   Lipase/vitellogenin       
IPR000734   TAG_lipase       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF57756   SSF57756       
SSF53474   SSF53474       
Gene 3D

Ontologies

Topology

Subcellular location
Secreted  
Length:
366
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
8.4359
Exp number, first 60 AAs:
0.46801
Total prob of N-in:
0.34038
outside
1  -  366
 
 

Population Genetic Test Statistics

Pi
67.599559
Theta
70.636133
Tajima's D
0.61683
CLR
0
CSRT
0.548072596370181
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号