SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04287
Pre Gene Modal
BGIBMGA012648
Annotation
Lipase_[Operophtera_brumata]
Full name
Lipase      
Location in the cell
Cytoplasmic   Reliability : 1.419 PlasmaMembrane   Reliability : 1.728
 

Sequence

CDS
ATGGTTAAAATTGGCCTTAGGACGTTCTTCATGATATTATCGATCGGCTTACACTTGACATCAGCAGTGTCCATCCTAGAATATCTATTTAATCTAGATGTAAACGAAAACGAGGATTCCAACTTCAAGGACCTGGTCATTAAATACGGTAAGGAATGCGAAGAGTATCAAGTTGTAACGGAGGATGGTTACATTTTAACTCTCTTCCGTATTCCCGGTGACGTCAATCGACCGGTATTGCTTGTGCACGGCTGTTTTGGTTCTGGGGATTCGTTCATCTTAAGGGGTAAGAAGTCGCTGGCTTACGCTCTAGCCGAGGCTGGCTACGACGTGTGGGTCTGCAACTATAGAGGAACTAAATACAGCAGGAAACATGTCACTGTAGATCCAGACCGCGACGACAAGTTCTGGGATTACAGCTTCGAAGAAATCGGTTACTACGACATGCCCGCGTTCATAGACTTCATCTTGGAGAAGACCGGACAAGCCAAGTTACAGACGATAGGATACTCGCAAGGAGGAACGGTCTTCTACGTAATGGGATCTATCAAGCCAGAATACAACGAGAAAATTAAGGTACTCATTTCCCTTGCGCCGATAGCACACTTTTATCACATCAAAAATCCAGTGACCAGGCTGTTCGAAAACGAATCACGTCTGAGTAACATTATCAATGCTATGGGCAAGGAAGAAATTTTTGGTCCACGATCAGGAGAACGAGCTATGATCGACGCGATTTGCTGGAGTCCGTTGACCGGCTATAAGATCTGTTCTCAGTTTTTATTCGAATTCGTTGGTTACGATGAGGACGAATGCGAACCGAAATTCTATTATAAATTAAAGCATTACATACCGAATAGCATTTCGAAAAAGAATGTCCAGCATTTACTCCAATTGAGGCGCGGTTTCAATCGATTCGATTACGGGCCGGAGAGGAACCTTGAGGTCTACAACGCGACATCGCCATCGAAATATGATTTGGATAAGGTCAAGATGAAAATTGTTCTGTACGTATCGAAAAACGATAGGTTGTCAACAGTGGAAGATGGCGAAGAACTACGGAATGAGTTCTCTAACGTTGTTGAATTTCGCATCATCGAACGCGACGAATTCAACCATTTAGATTTTATATGGGCCAAAAATATGGATAAATACATTTTCCCGCACATAATTCGAGCCTTGGAGCAATATAACTTCTAA
Protein
MVKIGLRTFFMILSIGLHLTSAVSILEYLFNLDVNENEDSNFKDLVIKYGKECEEYQVVTEDGYILTLFRIPGDVNRPVLLVHGCFGSGDSFILRGKKSLAYALAEAGYDVWVCNYRGTKYSRKHVTVDPDRDDKFWDYSFEEIGYYDMPAFIDFILEKTGQAKLQTIGYSQGGTVFYVMGSIKPEYNEKIKVLISLAPIAHFYHIKNPVTRLFENESRLSNIINAMGKEEIFGPRSGERAMIDAICWSPLTGYKICSQFLFEFVGYDEDECEPKFYYKLKHYIPNSISKKNVQHLLQLRRGFNRFDYGPERNLEVYNATSPSKYDLDKVKMKIVLYVSKNDRLSTVEDGEELRNEFSNVVEFRIIERDEFNHLDFIWAKNMDKYIFPHIIRALEQYNF

Summary

Similarity
Belongs to the AB hydrolase superfamily. Lipase family.
Feature
chain  Lipase
EMBL
BABH01038896    JTDY01008561    JTDY01003454    KOB64514.1    KOB69530.1    BABH01032765    + More
KQ460480    KPJ14361.1    KQ459580    KPI99336.1    JTDY01007194    KOB65389.1    ODYU01002476    SOQ40012.1    AGBW02010690    OWR48036.1    BABH01043411    BABH01034815    BABH01032763    BABH01038893    BABH01038894    KZ150080    PZC73881.1    GDQN01001224    JAT89830.1    KQ461196    KPJ06301.1    BABH01038949    AK403268    BAM19670.1    JTDY01002846    KOB70611.1    KPI99333.1    AGBW02011015    OWR47367.1    OWR48034.1    GAIX01002709    JAA89851.1    AGBW02008642    OWR52889.1    GALX01003535    JAB64931.1    CH940649    EDW64196.1    NWSH01002215    PCG68894.1    KRF81490.1    PCG68895.1    CH916368    EDW03610.1    EDW03611.1    CP012523    ALC38094.1    CH933807    EDW12736.1    CM002910    KMY89575.1    OUUW01000006    SPP81788.1    KQ460949    KPJ10406.1    CH480818    EDW52462.1    KK853197    KDR09957.1    KMY89574.1    JTDY01001496    KOB73727.1    JTDY01004649    KOB67911.1    AE014134    ADV37035.1    SPP81787.1    GBHO01027632    GBHO01024326    GBHO01024325    JAG15972.1    JAG19278.1    JAG19279.1    GDHC01011084    JAQ07545.1    CH902620    KPU73921.1    ADMH02001587    ETN61958.1    GEHC01000530    JAV47115.1    NEVH01009768    PNF32784.1    CH954177    KQS70596.1    CH379061    KRT04741.1    AY089586    AAF52971.1    AAL90324.1    EDV32370.2    GBRD01013485    JAG52341.1    CM000157    KRJ97507.1    JXUM01060253    KQ562094    KXJ76706.1    AGB92891.1    KQ971338    EFA01616.1    NWSH01000119    PCG79374.1    GL441846    EFN64155.1    KQ459598    KPI94527.1    CH963857    KRF98484.1    GDHF01006507    JAI45807.1    GL445305    EFN89852.1    EDV59018.1    EDV32371.1    EAL33105.2    KK852827    KDR15388.1    EDW87954.1    GAKP01013224    JAC45728.1    KK852794    KDR16428.1    CH479189    EDW25473.1    NWSH01002126    PCG69082.1    KZ150291    PZC71579.1    CH477320    EAT43642.1    EDW76558.1    JXUM01107700    KQ565165    KXJ71267.1    CM000361    EDX04568.1    ODYU01009113    SOQ53300.1    AXCM01001786    LJIJ01000287    ODM99328.1    KXJ71265.1    CH478517    EAT32845.1    CH477866    EAT35489.1    AGBW02008645    OWR52878.1    KQ459596    KPI95464.1    KMY89576.1    KK107054    EZA61581.1    GAMC01007031    JAB99524.1   
Pfam
PF00561   Abhydrolase_1        + More
PF04083   Abhydro_lipase
PF12146   Hydrolase_4
Interpro
IPR029058   AB_hydrolase        + More
IPR000073   AB_hydrolase_1       
IPR025483   Lipase_euk       
IPR006693   AB_hydrolase_lipase       
IPR022742   Hydrolase_4       
SUPFAM
SSF53474   SSF53474       
Gene 3D
PDB
1K8Q     E-value=1.68103e-47,     Score=478

Ontologies

Topology

SignalP
Position:   1 - 22,         Likelihood:  0.894763
 
 
Length:
399
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
6.73380999999999
Exp number, first 60 AAs:
6.6911
Total prob of N-in:
0.29386
outside
1  -  399
 
 

Population Genetic Test Statistics

Pi
425.771937
Theta
194.139198
Tajima's D
3.741945
CLR
0.299762
CSRT
0.996800159992
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号