SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04284  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA014288
Annotation
PREDICTED:_uncharacterized_protein_LOC106139693_isoform_X1_[Amyelois_transitella]
Location in the cell
Mitochondrial   Reliability : 1.76
 

Sequence

CDS
ATGAATTTCATATCGAACGTACTGGATTCGATTCCGGTTGTAGGCCACGTAAAAGGAATTGTTCATTATGCCGTTGGAGATACAGAAGGAGGCAACAATTCTATGTATCAATCTACAAGGACATCGGCGGTCCTAGCAGGAGGAGCAGTTGGATGCCTCGCAGGACCGGCAGGAGCTGCATTGGGAGGCGTATACGGAGGCATGATTACAGACGGCTTGGTTTCTGCGGCTAAGAACGAGCCTGTAGGTATTTTTGAGTCAAGTGCAAATATAGGTAGAGACATTGCTTCAGGCAAAAATCCAATGGCTTCTGTGGGTTCCGTAAGTTTCAAAATCGCCATGGACGGTATAGGTGGCTTTGGCATGGGAGGAGTTTCTAGCGTTGCCAGTAAAGTCCCGGCGAAGGCCGTCGCAAAAACCATAGAAGGCACTGTAAAAAAAGCTGCTGCAACTATTGGGGAGGAGATGATTGAGAAGTCAGTGCAATTAACTGCAGAAGAAATGACAAAAATTGTGGCAAAGAAAGTGTCAGAAAAAGCCGTGAAAAAAGCTGTCGAAACTGCAGCAATACAAACACAAATGCTTCTGGTGTCTGCTCACGTCGGAGTAAATGCTAGTGAAAAAACCAAAGCTGAAATGCGTGCTGAAGAAGAACGTAAACAACAGAAACAAAAAGAAGAAGAAAAAAAGGCGCGTGAAAATCGCGATAAAAAAAATACTGGATCGTGGCAACCGCCACGCGAGAACAGAAACAATAAAGAGTCCAATGTTGATAATGAAGAGTCCGACGAGGAGGTATTTGAAAAGTTCATGAAATTACTTAAACAGCTCTTGAAGCTTCTCTACGGCAATAACAGCGAACCGTTCACAAGAATTTTCGAGAATTTATCACCAGGCCAAATAGCGTATTTGGTGAAAATAATCAGAAACCTTAACTCAACTGGAATTTTACAGATAGTGTTAGATTTTACATTAAAACTGTTTAAATTGTACTTTTCTAAAGATATCTCATTCACAAATATCCTGAGTATGTTAGAATTCGTCGCAACTTACATTGAAGACCAGTTGTATTTTATGACCAAAACCAAAGGTAAGCCGACTCGTCAATCAGATGCCGACCGAAATGAGCGTCGAAGGAACGCCATCAAAGAACTTCAAAACAAAACGGATATAATTCAGAAAATTGCTGATCTATTCAGACATTTACAAGCGGAAATCATAGCTGAAACGAGCGCGCCTAATATAATTTCCCCCTATTTTCGTGATATATTCTCAGCTGTGTATCATTATTACAAACACAGACGCGTGCCCGTGCCAGGCCATGAGAAGCTGACAGTCAAACAATATTTCGACTTGATAAGGATGGTAATTATAAAAATGAAAGAATCACCGGAATACAAAAAAATGCAGAGGGCCAGAAATGGAGCGACCCTCACTTGTGAAATGTACGTTGTCTTGTTCGGTAGGATGTTCAGAATCATTATTACTGTTCGAGATGGTAAAATTGTATTGAGTACCGCCTATGTAGTCAAGCGTATGAACTTTAATGCCAAAGAAGGCATTCTTTACATAAAATTCGATGATGGAGATGTACAGCAGTAA
Protein
MNFISNVLDSIPVVGHVKGIVHYAVGDTEGGNNSMYQSTRTSAVLAGGAVGCLAGPAGAALGGVYGGMITDGLVSAAKNEPVGIFESSANIGRDIASGKNPMASVGSVSFKIAMDGIGGFGMGGVSSVASKVPAKAVAKTIEGTVKKAAATIGEEMIEKSVQLTAEEMTKIVAKKVSEKAVKKAVETAAIQTQMLLVSAHVGVNASEKTKAEMRAEEERKQQKQKEEEKKARENRDKKNTGSWQPPRENRNNKESNVDNEESDEEVFEKFMKLLKQLLKLLYGNNSEPFTRIFENLSPGQIAYLVKIIRNLNSTGILQIVLDFTLKLFKLYFSKDISFTNILSMLEFVATYIEDQLYFMTKTKGKPTRQSDADRNERRRNAIKELQNKTDIIQKIADLFRHLQAEIIAETSAPNIISPYFRDIFSAVYHYYKHRRVPVPGHEKLTVKQYFDLIRMVIIKMKESPEYKKMQRARNGATLTCEMYVVLFGRMFRIIITVRDGKIVLSTAYVVKRMNFNAKEGILYIKFDDGDVQQ

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
533
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
20.19322
Exp number, first 60 AAs:
14.69361
Total prob of N-in:
0.80102
POSSIBLE N-term signal
sequence
inside
1  -  42
TMhelix
43  -  65
outside
66  -  533
 
 

Population Genetic Test Statistics

Pi
231.870401
Theta
152.667128
Tajima's D
1.556877
CLR
0
CSRT
0.801109944502775
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 AKIIITFQRYYVNDSFYDFKNQGPVFLMIGGEGPADARWMVTGTWINYAKKFNALCINLEHRFYGESHPTL 99.62 0.0
28556443 IADLFR 100.00 1e-08
26280517 NDPVVITDFHDGPGWK 100.00 9e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 9e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 9e-04
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号