SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04283  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA012651
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC105841899?_partial_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.223
 

Sequence

CDS
ATGCAAACTTGTCTTAAAAATGTCATTAGCGAGATTCAAGTGTCCGTCAAATATTTTGTGTTCTGTGATGGCTACCGCCACACTCTGGTCAGTTCAGGCAACGGTTGGCTCGCCAAGCCTCCCCTTTGGGGGCTCACCCGATATCTGTCAAGACTATTCGAAAGTATGTACGCGCCGCCGGAATACGACGGTGAAGTCCCTGCTGAGGTGCCCCATATAACGGGGGCGGAGCTCCGTGTGGCCGTGCGCAAAATGTGTGCGAAGGACACTGCACCCGGCCCGGACGGCGTCCATGGCCGGGTTTGGGCCTTGGCTCTTGGTGCCCTAGGGGACCGACTCTTGAGGCTTTACAACTCCTGCCTCGAGTCGGGACGGTTTCCTTCATCGTGGAGGACGGGCAGACTCGTGCTGTTGAGAAAGGAAGGGCGCCCGGCCGATACTGCCGCCGGGTACCGTCCCATCGTGTTGCTGGATGAGGTGGGCAAGCTGCTGGAACGCATTCTGGCGGCCCGCATCATCCAGCATCTGGTCAGGGTGGGACCCGATCTGTCGGCGGAGCAGTATGGCTTCCGAGAGGGCCGCTCAACGGTAGACGCGATCCTTCGCGTGCGGGCCCTCTCGGAGGAGGCCGTCTCCAGGGGTGGGGTGGCTTTGGCGGTGTCGCTCGACATCGCCAATGCGTTTAACACCCTGCCCTGGTCCGTGATAAGGGGGGCGCTGGAACGACATGGAGTGCCTCCCTACCTTCGCCGGCTGGTGGGTTCCTACTTGGAGGACAGATCGGTCACGTGTACCGGACACGGTGGGATCCTGCACCGGTTCCCGGTCGTGCGCGGTGTTCCACAGGGGTCGGTGCTCGGCCCCCTTTTGTGGAATATCGGGTATGACTGGGTGCTGAGAGGTGCCCTCCTCCCGGGCCTGAACGTAATCTGTTACGAAGACGACACGTTGGTCGTGGCCCGGGGGGGTAGTTTTGCCGAGTCTGCCCGTCTTGCTACCGCTGGGGTGGCGCATGTCGTCGGCAAAATCAGGAGATTGGGCCTCGACGTGGCGCTCAGTAAATCCGAGGCCATGTGGTTCCACAGGCCCCGGAGAGTGCCACCTGTCGATGCCCATATCGTGAGCCTGGTCCCTCGTTTGTTGGGGGTGGCCGGCGCGTTAAGCCGGCTTCTGCCCAACGTCGGGGGGCCTGACCAGGTGACGCGCCGTCTCTATACGGGGGTGGTGCGATCAATGGCCCTATACGGGGCACCTGTGTGGGGCCAGTCCCTGGCCGCGGGGGTGGCGAAGCTGCTGCAACGGCCGCAACGCACCATCGCGGTCAGGGTCATCCGTGGTTATCGCACCATCTCCTTTGAGGCGGCGTGTGTACTGGCTGGGACGCCGCCTTGGGTTCTGGAAGCGGAGGCGCTCGCCGCTGACTATCAGTGGCGGGCTGACCTTCGTGCCCGGGACGTGGCGCGTCCCAGCCCCAGTGTGGTCAGAGCGCGGAGGGCCCAATCTCGGCGACGGCTGGCTGATCCTTCGGCTGGTCGTAGGACCGTCGAGGCGATTCGCCCGGTCCTTGTGGATTGGGTGAATCGTGACAGAGGACGCCTCACTTTCCGGCTCACGCAGGTGCTCACTGGGCATGGTTGCTTCGGTGAGTTCCTGCACCGGATCACAGCCGAGCCGACGGCAGAGTGCCACCATTGTGGTTGCGACTTCGACACGGCAGAGCATACGCTCGTCGCCTGCCCCGCATGGGAGGGGTGGCGCCGTGTCCTCGTCGCAAAAATAGGAAACGACTTGTCGTTGCCGAGTGTTGTGGCATCGATGCTCGGCGACGACGAGTCGTGGAAGGCGATGCTCGACTTCTGCGAGTGCACCATCTCGCAGAAGGAGGCGGCGGGGCGCGCCACGACGACTTCACGTGGGGGTGCGTTCTGGTGGTCGCCCGAGATCGCGAGACTCCGTGAGGAGTGCGTGAGGGCGCGCCGCCGGAGCGCACGCCACCGCCGCCGCCGTCGTCGCGACGCTGCGTTCGCGGAGACGGCGGCCCAGCTGCACGCTGACTGTCGTCAAAAGCAGACGGCGCTGCAGCTGGCCATCGGCGAGGCCAAGAAGCAGAGCATGAAGACTCTCCTGGAGTCGCTCGACGAAGATCCCTGGGGGCGCCCATACAAGATGGTTCGCAGGAAACTGCAGCCGTGGGCGCTCCCGGTGACCGAGCGGCTCCAGCCTCGGCAGCTGCGGGAGATAGTTTCCGCGCTTTTCCCGCCGGCAGCGGGGGGGGACTTTGAGCCCCCCCAGATGGACGCCACGTGGGGCACACCTCCACGTCGCCCCAGCGTTCCCGCTGCCGAGGAGCCCCCTCCCCCTATCACGGGGGCGGAGATCCATGCGGCCGTGTCCAAAATGAGAGCGAAGGACACGGCCCCCGGCCCTGACGGCGTTCACGGCCGGGTCTGGAGCTTGGCCTTCGAGGCCCTAGGGGACCGGCTCGGGGGGCTTTTCGAAGCGTGCCTCGAGTCGGGACGGTTCCCGTCGAAATGGAAGACGGGCAGACTGGTCCTTCTGCGGAAGGACGGGCGCCCCGCGGACTCACCCGCGGGCTATCGCCCCATCGTGTTGCTGGACGAAGCGGGCAAGATGCTCGAGAGAATCGTCGCCGCCCGCATCGTCCGGCACCTGACCGAGACGGGTCCCGATCTTTCGGCGGAGCAATACGGCTTCAGAGAGGGCCGCTCGACTATCGACGCAATTCTGCGCGTGCGGGCCCTCTCCGACGAAGCCGTATCCCGGGGCGGGGTGGCGATGGCGCTATCCTTAGATGTAAGGAACGCCTTCAACACCCTGCCCTGGTCGGTGATCGCGGGGGCGCTGGAGTATCACGGCGTCCCCGCATACCTCCGCCGACTGATCGGCTCCTACCTCGAGGGCAGGTCGATCCAGTGCATCGGACACGGTGGGACGATGTACCGCTTCCCCGTCGAGCGCGGTGTTCCGCAGGGGTCTGTCCTGGGCCCCCTGCTGTGGAACATCGGCTACGACTGGGTCCTGCGGGGCGTCATTCGGGGTCCCCTCCCCGGGCTGAGCGTAATATGTTACGCCGACGACACGTTGGTCGTGGCTCCGGGGAGGGACTACCGGGAGTCTGCCCGTCTGGCGTGCGCAGGCGTGGCACACGTCGTCACTAGGATCCGACGGTTGGGGCTCGAGGTGGCGCTCGATAAAACCCAGGCCCTGCTTTTTCACGGGCCGGGACGAGCGCCGCCTGTGGGTGCCCACCTCGTGATCGGAGGCGTCCGCGTCGGGGTTGGGGTGACCGGTCTTCGGTACCTCGGCCTCGAACTGGATAGTCGGTGGAACTTCCGCGCTCACTTTGAGAAGTTGGGCCCTCGACTGATGGCGACGGCCGGCTCTCTGAGCCGGCTGCTTCCAAACGTCGGGGGTCCCGATCAGGTGGCGCGCCGCCTCTACATGGGGGTGGTGCGGTCGATGGCACTATACGGGGCTCCCGTATGGTGCCGCGCCCTGACCCGCAAGAACGTCGCGGCTCTGCGACGTCCGCAGCGTGCGATCGCGGTCAGGGCGATCCGAGGATACCGCACCGTCTCCTTCGAGGCGGCGTGCTTGCTCGCCGGGGCGCCACCCTGGGACCTGGAGGCGGAGGCGCTCGCTGCCGATTACAGGTGGCGTAGCGACCTCCGCTCTAGGGGGGAAGGGCGCCCCGGCGAAGGTGTAGTTCGAGCGCGGAGGCTCCACTCTCGGCGGTCCGTGCTGGAGGCGTGGTCTCGCCGCTTGGCGGACCCGTCGGCCGGCCTCCGAACCGTCGAGGCGGTCCGCCCGGTTCTCGCGGACTGGGTGGGCCGCGACCGCGGATGCCTCACCTTCCGGCTAACGCAGATGCTTACCGGCCATGGTTGTTTCGGCCGGTACTTGCACAAGATAGCCGGAAGGGAACCGACGGCGCAGTGCCACCACTGCGCGGACCGCGACGAGGAAGACACAGCGGAACACACGCTGGCGCGTTGCTCTGGATTCGACGAGCAACGCGCCGCCCTCGTCGCGGTCATAGGAGAGGACCTCTCGCTGCCGCGCGTCGTGGCTACGATGCTCGGCAGCGACGCGTCCTGGAAGGCGATGCTCGACTTCTGCGAGTCCACCATCTCGCAGAAGGAGGCGGCGGAGCGAGAGAGGGAGAGCTCTTCCCTTTCCGCACCGATCCGTCGCCGTCGAGCCGGGGGCCGGAGGCGGGAATACGCCCATAATCTCAACCCAACTGGGATGTCTTTGAAGAATAGGTTAATTGCATGTCTGCAAAAACTGAAGGAATACGATTACACTGACGTAGACAAGGCAAGAGCTAGTGACGCGAAGGCCGAGAATGCCCTCAACTTAATATACCAGACTGCTTTAAAGAAAACAACTTTTACACCAGAAGAGAAGAAAATTGTAGGTTCTCTTTTATTTGATGCCATCACACCGATACAAAGCAACATAGAAGGAACGCTCTGCGAATACAGAACTAGATTAGATACCTCTGTGCTTATGAAAAGATCTGCAATACAATTCTTGATTGACGAATACGGGAAGTTTCCAGTTGAGAATTCTATCTTGGCTACAAAGTTAGAGGAAGCCGGCATAGCAGAGAGCGTTGAAATACTCAATGAAATTATAAATAGGACATCGGCGGTCCTAGCAGGAGGAGCAGTTGGATGCCTCGCAGGACCGGCAGGAGCTGCATTGGGAGGCGTATACGGAGGCATGATTACAGACGGCTTGGTTTCTGCGGCTAAGAAGGAGCCTGTAGGTATTTTTGAGTCAAGTGCAAATATAGGTAGAGACATTGCTTCAGGCAAAAATCCAATGGCTTCTGTGGGTTCCGCAAGTTTCAAAATCGCCATGGACGGTATAGGTGGCTTTGGCATGGGAGGAGTTTCTAGCGTTGCCAGTAAAGTCCCGGCGAAGGCCGTCGCAAAAACCATAGAAGGCACTGTAAAAAAAGCTGCTGCAACTATTGGGGAGGAGATGATTGAGAAGTCAGTGCAATTAACTGCAGAAGAAATGACAAAAATTGTGGCAAAGAAAGTGTCAGAAAAAGCCGTGAAAAAAGCTGTCGAAACTGCAGCAATACAAACACAAATGCTTCTGGTGTCTGCTCACGTCGGAGTAAATGCTAGTGAAAAAACCAAAGCTGAAATGCGTGCTGAAGAAGAACGTAAACAACAGAAACAAAAAGAAGAAGAAAAAAAGGCGCGTGAAAAGCGCGATAAAAAAAACACTGGATCGTGGGAACCACCACGCGAGAACAGAAACAATAAAGAGTCCAATGTTGATAATGAAGAGTCCGACGAGGAGGTATTTGAAAAGTTCATGAAATTACTTAAACAGCTCTTGAAGCTTCTATACGGCAATAACAGCGAACCGTTCACAAGAATTTTCGAGAATTTATCACCAGGCCAAATAGCGTATTTGGTGAAAATAATCAGAAACCTTAACTCAACTGGAATTTTACAGATAGTGTTAGATTTTACATTAAAACTGTTTAAATTGTACTTTTCTAAAGATATCTCATTCACAAATATCCTGAGTATGTTAGAATTCGTCGCAACTTACATTGAAGACCAGTTGTATTTTATGACCAAAACCAAAGGTAAACCGACTCGTCAATCAGATGCCGACCGGAATGAGCGTCGAAGGAACGCCATCAGAGAACTTCAAAACCAAAGGGATATAATTCAGAAAATTGCTGATCTATTCAGACATTTACAAGCGGAAATCATAGCTGAAACGAGCGCGCCTAATATAATTTCCCCCTATTTCCGTGATATATTCTCAGCTGTGTATCATTATTACAAACACAGACGCGTGCCCGTGCCAGGCCATGAGAAGCTGACAGTCAAACAATATTTCGACTTGATAAGGATGGTAATTATAAAAATGAAAGAATCACCGGAATACAAAAAAATGCAGAAGGCCAGAAATGGAACGACCCTCACTTGTGAAATGTACGTGGTCTTGTTCGGTAGGATGTTCAGAATTATTATTACTGTTCGAGATGGTGAAATTGTATTGAGTACCGCCTATGTAGTCAAGCGTATGAACTTTAATGCCAAAGAAGGCATTCTTTACATAAAATTCGGTGATGGAGATGTACAGAAGTAA
Protein
MQTCLKNVISEIQVSVKYFVFCDGYRHTLVSSGNGWLAKPPLWGLTRYLSRLFESMYAPPEYDGEVPAEVPHITGAELRVAVRKMCAKDTAPGPDGVHGRVWALALGALGDRLLRLYNSCLESGRFPSSWRTGRLVLLRKEGRPADTAAGYRPIVLLDEVGKLLERILAARIIQHLVRVGPDLSAEQYGFREGRSTVDAILRVRALSEEAVSRGGVALAVSLDIANAFNTLPWSVIRGALERHGVPPYLRRLVGSYLEDRSVTCTGHGGILHRFPVVRGVPQGSVLGPLLWNIGYDWVLRGALLPGLNVICYEDDTLVVARGGSFAESARLATAGVAHVVGKIRRLGLDVALSKSEAMWFHRPRRVPPVDAHIVSLVPRLLGVAGALSRLLPNVGGPDQVTRRLYTGVVRSMALYGAPVWGQSLAAGVAKLLQRPQRTIAVRVIRGYRTISFEAACVLAGTPPWVLEAEALAADYQWRADLRARDVARPSPSVVRARRAQSRRRLADPSAGRRTVEAIRPVLVDWVNRDRGRLTFRLTQVLTGHGCFGEFLHRITAEPTAECHHCGCDFDTAEHTLVACPAWEGWRRVLVAKIGNDLSLPSVVASMLGDDESWKAMLDFCECTISQKEAAGRATTTSRGGAFWWSPEIARLREECVRARRRSARHRRRRRRDAAFAETAAQLHADCRQKQTALQLAIGEAKKQSMKTLLESLDEDPWGRPYKMVRRKLQPWALPVTERLQPRQLREIVSALFPPAAGGDFEPPQMDATWGTPPRRPSVPAAEEPPPPITGAEIHAAVSKMRAKDTAPGPDGVHGRVWSLAFEALGDRLGGLFEACLESGRFPSKWKTGRLVLLRKDGRPADSPAGYRPIVLLDEAGKMLERIVAARIVRHLTETGPDLSAEQYGFREGRSTIDAILRVRALSDEAVSRGGVAMALSLDVRNAFNTLPWSVIAGALEYHGVPAYLRRLIGSYLEGRSIQCIGHGGTMYRFPVERGVPQGSVLGPLLWNIGYDWVLRGVIRGPLPGLSVICYADDTLVVAPGRDYRESARLACAGVAHVVTRIRRLGLEVALDKTQALLFHGPGRAPPVGAHLVIGGVRVGVGVTGLRYLGLELDSRWNFRAHFEKLGPRLMATAGSLSRLLPNVGGPDQVARRLYMGVVRSMALYGAPVWCRALTRKNVAALRRPQRAIAVRAIRGYRTVSFEAACLLAGAPPWDLEAEALAADYRWRSDLRSRGEGRPGEGVVRARRLHSRRSVLEAWSRRLADPSAGLRTVEAVRPVLADWVGRDRGCLTFRLTQMLTGHGCFGRYLHKIAGREPTAQCHHCADRDEEDTAEHTLARCSGFDEQRAALVAVIGEDLSLPRVVATMLGSDASWKAMLDFCESTISQKEAAERERESSSLSAPIRRRRAGGRRREYAHNLNPTGMSLKNRLIACLQKLKEYDYTDVDKARASDAKAENALNLIYQTALKKTTFTPEEKKIVGSLLFDAITPIQSNIEGTLCEYRTRLDTSVLMKRSAIQFLIDEYGKFPVENSILATKLEEAGIAESVEILNEIINRTSAVLAGGAVGCLAGPAGAALGGVYGGMITDGLVSAAKKEPVGIFESSANIGRDIASGKNPMASVGSASFKIAMDGIGGFGMGGVSSVASKVPAKAVAKTIEGTVKKAAATIGEEMIEKSVQLTAEEMTKIVAKKVSEKAVKKAVETAAIQTQMLLVSAHVGVNASEKTKAEMRAEEERKQQKQKEEEKKAREKRDKKNTGSWEPPRENRNNKESNVDNEESDEEVFEKFMKLLKQLLKLLYGNNSEPFTRIFENLSPGQIAYLVKIIRNLNSTGILQIVLDFTLKLFKLYFSKDISFTNILSMLEFVATYIEDQLYFMTKTKGKPTRQSDADRNERRRNAIRELQNQRDIIQKIADLFRHLQAEIIAETSAPNIISPYFRDIFSAVYHYYKHRRVPVPGHEKLTVKQYFDLIRMVIIKMKESPEYKKMQKARNGTTLTCEMYVVLFGRMFRIIITVRDGEIVLSTAYVVKRMNFNAKEGILYIKFGDGDVQK

Summary

Uniprot
ProteinModelPortal
PDB
6AR3     E-value=0.000156264,     Score=114

Ontologies

GO

Topology

Length:
2049
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.648600000000001
Exp number, first 60 AAs:
0.01513
Total prob of N-in:
0.00316
outside
1  -  2049
 
 

Population Genetic Test Statistics

Pi
349.493608
Theta
20.890825
Tajima's D
3.265808
CLR
0.34382
CSRT
0.988800559972001
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 AKIIITFQRYYVNDSFYDFKNQGPVFLMIGGEGPADARWMVTGTWINYAKKFNALCINLEHRFYGESHPTL 97.85 0.0
28556443 SAIQFLIDEYGK 100.00 4e-09
28556443 EYDYTDVDK 100.00 1e-05
28556443 LDTSVLMK 100.00 0.007
26280517 NDPVVITDFHDGPGWK 100.00 0.008
28556443 IAMDGIGGFGMGGVSSVASK 100.00 0.008
28556443 IAMDGIGGFGMGGVSSVASK 100.00 0.008
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号