SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04223
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.516
 

Sequence

CDS
ATGCTCGGTGCTAGCACGAGCCGCCACGGGGATGTTTGCATTGAGCACGTACGTATTATAGAAAATGAAGGCGTAGGATTTGTTCATAAAAGGGTCGTTAACAACTTGCGTTATGCGGACGACACTATCCTTATTGCAGCATCGGAAGCCGATTTGCAAGCAATTGTGAATAAGGTTAATGAGTGCAGCGAAGAAGCCGGGTTGTCGATAAACATAAGCAAGACCAAGTTCATGGTAGTCTCAAGAAACCCGGATTTGAGTTCAAGCGTATCTGTAGCTGGGAAACAACTAGAGCGGGTACGACAGTACAAGTATTTAGGGGCTTGGGTAAACGAAGCATGGGAATCTGATCAAGAAATCAAGACCCGGATAGAAACTGCTCGAGCCTCTTTTAATAAAATGAGGAAAGTTCTTTGCTGTCGTCAACTGAATATAAAGCTCCGAGTCAGGCTACTCATGTGCTATATCTGGCCTATCGTCATGTATGGTTGCGAAACGTGGACCCTGAAAGAGGACACTACAAGACGCCTACAGGCATTCGAGATGTGGTGCTACCGTCGCATGTTACGCATTGGTTGGACGCAGAGGGTCAGGAACGAAACCGTGCTTCAGCGCGTTCATATGTCCCGGAAAATGCTGCCTGCTATCAAAAAGCGCAAGATAGAGTATCTCGGCCACGTGCTCAGGAACGATCGATACATGCTGCTCCAGCTGATAATTATGGGCAAAGTGGACGGAAAGAGACGTGCTGAGCGAAGAAAGAAATCATGGCTCCGGAATATCCGGGAGTGGACCGGTATTGCCTCCGTCGAACAGCTGTTCCGGTTGGCTGCAGATAAAAACGAATATAGAAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MLGASTSRHGDVCIEHVRIIENEGVGFVHKRVVNNLRYADDTILIAASEADLQAIVNKVNECSEEAGLSINISKTKFMVVSRNPDLSSSVSVAGKQLERVRQYKYLGAWVNEAWESDQEIKTRIETARASFNKMRKVLCCRQLNIKLRVRLLMCYIWPIVMYGCETWTLKEDTTRRLQAFEMWCYRRMLRIGWTQRVRNETVLQRVHMSRKMLPAIKKRKIEYLGHVLRNDRYMLLQLIIMGKVDGKRRAERRKKSWLRNIREWTGIASVEQLFRLAADKNEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    GDHC01017214    JAQ01415.1    + More
GBHO01028834    JAG14770.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    LBMM01003995    KMQ92919.1    LBMM01001656    KMQ95932.1    GGMS01004979    MBY74182.1    NWSH01001998    PCG69477.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    HACG01049245    CEK96110.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    RQTK01000625    RUS76894.1    HACG01049255    CEK96120.1    RQTK01000209    RUS84333.1    RQTK01000685    RUS76136.1    AFYH01119920    NEVH01025635    PNF15414.1    NEVH01010478    PNF32508.1    NEVH01001347    PNF42965.1    ABLF02038495    GGMR01016842    MBY29461.1    NEVH01026085    PNF14932.1    NEVH01007405    PNF35773.1    NEVH01004413    PNF39563.1    NEVH01025651    PNF15155.1    NEVH01019967    PNF22088.1    NEVH01013245    PNF29434.1    NEVH01005288    PNF38924.1    NEVH01006565    PNF37921.1    NEVH01017443    PNF24479.1    NEVH01015827    PNF26505.1    NEVH01003494    PNF40693.1    NEVH01025174    PNF15486.1    NEVH01004414    PNF39430.1    NEVH01012097    PNF30370.1    NEVH01008283    PNF34242.1    NEVH01000251    PNF43864.1    NEVH01015814    PNF26746.1    NEVH01017562    PNF23821.1    NEVH01012082    PNF30956.1    NEVH01011193    PNF31991.1    NEVH01002704    PNF41497.1    NEVH01017534    PNF24119.1    NEVH01021956    PNF18969.1    NEVH01013550    PNF28814.1    NEVH01002141    PNF42600.1    NEVH01001338    PNF43058.1    NEVH01024952    PNF16338.1    ABLF02046942    ABLF02059971    NEVH01003502    PNF40578.1    NEVH01021229    PNF19699.1    NEVH01024426    PNF17169.1    NEVH01006732    PNF36770.1    NEVH01024527    PNF17048.1    NEVH01015826    PNF26547.1    PNF16321.1    NEVH01002690    PNF41636.1    NEVH01009084    PNF33722.1    GDRN01098129    JAI59014.1    GGMS01001369    MBY70572.1    NEVH01020341    PNF21589.1    NEVH01021197    PNF19999.1    NEVH01015882    PNF26389.1    NEVH01024421    PNF17406.1    NEVH01015905    PNF26381.1    NEVH01024955    PNF16252.1    NEVH01024544    PNF16826.1    NEVH01021193    PNF20060.1    NEVH01020856    PNF21060.1    NEVH01011192    PNF32037.1    NEVH01007823    PNF35207.1    NEVH01014359    PNF27807.1    NEVH01026089    PNF14819.1    NEVH01003505    PNF40530.1    NEVH01013563    PNF28562.1    NEVH01011876    PNF31534.1    NEVH01021216    NEVH01021205    NEVH01018378    NEVH01016294    NEVH01013243    NEVH01011194    NEVH01011186    PNF19803.1    PNF19913.1    PNF23519.1    PNF26082.1    PNF29477.1    PNF31895.1    PNF32189.1    NEVH01021939    PNF19136.1    NEVH01011198    PNF31808.1    NEVH01007419    PNF35717.1    NEVH01020871    PNF20746.1    NEVH01017570    PNF23798.1    NEVH01002692    PNF41604.1    NEVH01027118    PNF13626.1    NEVH01020867    PNF20816.1    PNF24114.1    NEVH01006832    PNF36369.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    NEVH01022644    PNF18361.1    NEVH01007402    PNF35873.1    NEVH01012088    PNF30586.1    NEVH01009398    PNF33134.1    NEVH01007824    PNF35186.1    NEVH01017450    PNF24326.1    NEVH01008232    PNF34368.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
SUPFAM
SSF56219   SSF56219       
Gene 3D
PDB
5HHL     E-value=0.0250114,     Score=86

Ontologies

Topology

Length:
292
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.1003
Exp number, first 60 AAs:
0
Total prob of N-in:
0.06562
outside
1  -  292
 
 

Population Genetic Test Statistics

Pi
4.436102
Theta
15.772722
Tajima's D
-1.408825
CLR
16.67861
CSRT
0.0686965651717414
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号