SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04211
Pre Gene Modal
BGIBMGA010729
Annotation
PREDICTED:_uncharacterized_protein_LOC105663895_[Megachile_rotundata]
Location in the cell
Nuclear   Reliability : 2.444
 

Sequence

CDS
ATGATTCGTGTGGAGGTAAATTTCAGAAACGAAAATTGGTCAGAAGTTTTGTGGAAACTGCAGCTCACCCTGAACATTACGAAACAAAAGTCCACTCAATATTCACCTTTATATTTGTTAATTGGTAGCGATGCTGTGACGCCCGTCATTCGTTCCGTTGTACGCGATGTGGCTCTAGAAGGAACAAGTGCCAACAGAGAAACCTTACGCGAGCTTGCCCGACAAAGAGCTTCTCAACTGCTGGACAAAAACCGAAAACAGCAGGACACTCGAGTAAATGAACGGCGCAAACCCCCGCGTACTTTCCATGAAAACGACGTGGTCTTCGTGCATAAGAATAGCCAATCTGTTGGAAAGCTGGATTCTGGTATGCGTGGCCCGTACAAAATAGTGCGTGCGCTGCCACATGGACGTTATGAACTGAAGCTTCTTTCTGGCTCACTTGGGAAGACCACGAAAGCTGCTGCCGAATTTATAAGTGCGTGGCACGGAGAGTGGACGCCGGATGTGTGCACCGCATTTTTCGAGTGTGATGAGAATAGCTCTGAGGAAGGTATTGTTGCCGGTCCATCACACCACCATGACGACATAGTACCTCTAGACGGACCTATTAATGCGGGCGAGGACGCTCCGCCGTCAGGAGAGGCCGTGTTAGAAGATGATGATGACATTGGAGGCGTGGCCTAA
Protein
MIRVEVNFRNENWSEVLWKLQLTLNITKQKSTQYSPLYLLIGSDAVTPVIRSVVRDVALEGTSANRETLRELARQRASQLLDKNRKQQDTRVNERRKPPRTFHENDVVFVHKNSQSVGKLDSGMRGPYKIVRALPHGRYELKLLSGSLGKTTKAAAEFISAWHGEWTPDVCTAFFECDENSSEEGIVAGPSHHHDDIVPLDGPINAGEDAPPSGEAVLEDDDDIGGVA

Summary

Pfam
PF17921   Integrase_H2C2        + More
PF00665   rve
PF00078   RVT_1
PF00077   RVP
PF17919   RT_RNaseH_2
PF00098   zf-CCHC
PF02037   SAP
PF17917   RT_RNaseH
PF00385   Chromo
PF03732   Retrotrans_gag
PF12384   Peptidase_A2B
Interpro
IPR036397   RNaseH_sf        + More
IPR041588   Integrase_H2C2       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR001878   Znf_CCHC       
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR041577   RT_RNaseH_2       
IPR000477   RT_dom       
IPR018061   Retropepsins       
IPR021109   Peptidase_aspartic_dom_sf       
IPR036875   Znf_CCHC_sf       
IPR003034   SAP_dom       
IPR041373   RT_RNaseH       
IPR036361   SAP_dom_sf       
IPR016197   Chromo-like_dom_sf       
IPR023780   Chromo_domain       
IPR000953   Chromo/chromo_shadow_dom       
IPR005162   Retrotrans_gag_dom       
IPR024650   Peptidase_A2B       
SUPFAM
SSF53098   SSF53098        + More
SSF50630   SSF50630       
SSF57756   SSF57756       
SSF68906   SSF68906       
SSF54160   SSF54160       
Gene 3D

Ontologies

Topology

Length:
228
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.07523
Exp number, first 60 AAs:
0.07523
Total prob of N-in:
0.13347
outside
1  -  228
 
 

Population Genetic Test Statistics

Pi
125.233777
Theta
71.080705
Tajima's D
1.843806
CLR
551.703335
CSRT
0.856307184640768
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号