Gene
KWMTBOMO04140
Pre Gene Modal
BGIBMGA008712
Annotation
PREDICTED:_Bardet-Biedl_syndrome_5_protein_homolog_[Bombyx_mori]
Full name
Bardet-Biedl syndrome 5 protein homolog
+ More
Bardet-Biedl syndrome 5 protein
Bardet-Biedl syndrome 5 protein
Location in the cell
PlasmaMembrane Reliability : 0.952
Sequence
CDS
ATGTCGAAGGCTAAATCCGGTGCCGTTTGGGAAGACAGGGAAGTACTATTCGATCTGCCTTTCGCGTACTTAAAACTACGTCCAGGAGAGAAAATCTTCGACAGAATAGAGCCTATTGAGGATACGAAAGGGAACAGCGGTGTCAAAGGACGAATGGTCGTCACGAGTCTCAGGATTATATGGCACTCGTTGGCATCGCCCAGAATTAATATGTCTATTGGCTTGAACTGTCTCCTCTCGACGAGCACCAAGGTCGTGAACTCTGGTCTCCGTGGAACGACACAGGCTCTGCACGCGTTGGCAGCGTACCGAACTAACAGATACGAATTTATCTTCACGAATTTGTCGCCGAACTGCGTCCGCCATTACACCTCTGTTGTCGGAGTTCACAAAGCTTACATCAATTCGAGATTGTACAGAGATCTGAAGCTGCGTGGGGCGATCATACATAACAAACAACTGAGAATGGTGCCTCAGGAAAAGATTCTGCTTAACGAACACAGTATCTGGAATCTGTCTAGCGACTCCGGGAATCTTGGCACGATGCTGGTAACGAATATCAGAGTTGTATGGTACGCTGACGTGAACGAGGCTTTCAACGTGTCCATGCCGTACATAACTATTGATAGCATTTCAGTCAGAGCATCGAAATTCGGCGAGGCCTTAGTGTTCGTCATCAGACAAACATCGGGAGGTTATGTGCTCGGTTTCCGGGCGGACCCGCGGGATCGGCTGCCTCCATTGCTGTCTGAACTCCAAACACTCCATCGAGCTTATACCGAGAAACCCATATTTGGGGTCGAAATTAACTGGGAGAATGAGGCTCCAACTACAATCAATGATGAGATTGAAGAGCTAGAAGAGATAGGAGAACCTCGAGGGGAGATGGGGCCAAGTTTATATATGGCATCTCAATTGGCCAAACATCAAGAAGGCAAGGACGTTCAGCCAGTTTACAGCCCGTATTTAGGACTCGCTATAGAACCATTGAAAGAAGGTTTTACCCTCAAAAGCTTGTTTGAAGTTCAAAGTACAACTTAA
Protein
MSKAKSGAVWEDREVLFDLPFAYLKLRPGEKIFDRIEPIEDTKGNSGVKGRMVVTSLRIIWHSLASPRINMSIGLNCLLSTSTKVVNSGLRGTTQALHALAAYRTNRYEFIFTNLSPNCVRHYTSVVGVHKAYINSRLYRDLKLRGAIIHNKQLRMVPQEKILLNEHSIWNLSSDSGNLGTMLVTNIRVVWYADVNEAFNVSMPYITIDSISVRASKFGEALVFVIRQTSGGYVLGFRADPRDRLPPLLSELQTLHRAYTEKPIFGVEINWENEAPTTINDEIEELEEIGEPRGEMGPSLYMASQLAKHQEGKDVQPVYSPYLGLAIEPLKEGFTLKSLFEVQSTT
Summary
Description
Required for ciliogenesis.
The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for BBSome complex ciliary localization but not for the proper complex assembly (By similarity).
The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for BBSome complex ciliary localization but not for the proper complex assembly.
The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for BBSome complex ciliary localization but not for the proper complex assembly (By similarity).
The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for BBSome complex ciliary localization but not for the proper complex assembly.
Subunit
PPart of BBSome complex, that contains BBS1, BBS2, BBS4, BBS5, BBS7, BBS8/TTC8, BBS9 and BBIP10. Binds to phosphoinositides. Interacts with CCDC28B. Interacts with SMO; the interaction is indicative for the association of SMO with the BBsome complex to facilitate ciliary localization of SMO. Interacts with PKD1 (By similarity).
Part of BBSome complex, that contains BBS1, BBS2, BBS4, BBS5, BBS7, BBS8/TTC8, BBS9 and BBIP10. Binds to phosphoinositides. Interacts with CCDC28B. Interacts with SMO; the interaction is indicative for the association of SMO with the BBsome complex to facilitate ciliary localization of SMO. Interacts with PKD1 (PubMed:24939912).
Part of BBSome complex, that contains BBS1, BBS2, BBS4, BBS5, BBS7, BBS8/TTC8, BBS9 and BBIP10 (By similarity). Binds to phosphoinositides (By similarity). Interacts with CCDC28B. Interacts with SMO; the interaction is indicative for the association of SMO with the BBsome complex to facilitate ciliary localization of SMO (By similarity). Interacts with PKD1 (By similarity).
Part of BBSome complex, that contains BBS1, BBS2, BBS4, BBS5, BBS7, BBS8/TTC8, BBS9 and BBIP10. Binds to phosphoinositides. Interacts with CCDC28B. Interacts with SMO; the interaction is indicative for the association of SMO with the BBsome complex to facilitate ciliary localization of SMO. Interacts with PKD1 (PubMed:24939912).
Part of BBSome complex, that contains BBS1, BBS2, BBS4, BBS5, BBS7, BBS8/TTC8, BBS9 and BBIP10 (By similarity). Binds to phosphoinositides (By similarity). Interacts with CCDC28B. Interacts with SMO; the interaction is indicative for the association of SMO with the BBsome complex to facilitate ciliary localization of SMO (By similarity). Interacts with PKD1 (By similarity).
Miscellaneous
BBS5 may interact genetically with BBS1.
Similarity
Belongs to the BBS5 family.
Keywords
Cell membrane
Cell projection
Cilium
Complete proteome
Cytoplasm
Cytoskeleton
Membrane
Reference proteome
Protein transport
Transport
Alternative splicing
Bardet-Biedl syndrome
Ciliopathy
Disease mutation
Mental retardation
Obesity
Sensory transduction
Vision
Feature
chain Bardet-Biedl syndrome 5 protein homolog
splice variant In isoform 2.
sequence variant In BBS5; dbSNP:rs121908581.
splice variant In isoform 2.
sequence variant In BBS5; dbSNP:rs121908581.
Uniprot
H9JGR5
A0A3S2NYX1
A0A2H1W1F4
A0A2W1BXD7
A0A2A4JXJ2
A0A0N1IFC5
+ More
A0A212F450 A0A0N1PGX0 A0A0L7LUY1 D6W797 A0A1B6DL88 A0A210PII7 A0A067QHW0 C3YBX4 A0A2P8YK66 K4FYP4 A0A151M038 A0A091HMF3 R7V9C2 U6CSK7 A4IHK9 Q7ZWB7 A0A1L8EW62 A0A2Y9IPI8 A0A2D4JI63 H3AVK0 F1S1V8 A0A3Q7S2A9 C1BIX4 G1LVU0 A0A384BSV4 A0A3Q7UIX3 A0A2U3XTJ5 A0A2U3VPK3 A0A384A7G1 A0A2I2U646 A0A091TTR5 A0A3Q7NWX5 A0A1U7SR99 Q9CZQ9 A0A091U941 L8J296 A0A1S3IPG7 U3IHD0 A0A3Q0D6T2 A0A2R9BWT6 K7CV40 A0A0S2Z626 Q8N3I7 A6QLF9 A0A2Y9FGN8 S4R8D7 H2P7R4 A0A2K5CK52 G1QY66 F7EG67 A0A091CX66 E0W305 F6VTH6 A0A287D381 A0A2I2ZW94 A0A2I0MIQ2 A0A341CTL4 A0A2Y9N2Q6 W5KEJ5 W5NZN3 A0A1V4K6I9 A0A2I0UTP7 A0A1S3ARM9 A0A091UUH3 B2RZ48 G1P0F6 A0A369RQE2 B3RQQ8 A0A2K6CE66 A0A2K6KG14 G7PKR7 A0A2K5Z6D8 A0A0D9RRT6 A0A096NZB9 A0A2K6NDM7 A0A2K5LNC6 H9Z224 Q4R649 A0A3L8SNI7 H0ZBX4 A0A340WUL5 G3T4E0 A0A093GWF7 H2MRS1 A0A3P8YYM9 A0A3B4DU96 A0A1W4Y7X3 A0A2T7PC08 A0A2K5QZH3 A0A1W4Z903 A0A2I2Z8B3 A0A3Q3J2R1 W5MN19 A0A2U3V9C2
A0A212F450 A0A0N1PGX0 A0A0L7LUY1 D6W797 A0A1B6DL88 A0A210PII7 A0A067QHW0 C3YBX4 A0A2P8YK66 K4FYP4 A0A151M038 A0A091HMF3 R7V9C2 U6CSK7 A4IHK9 Q7ZWB7 A0A1L8EW62 A0A2Y9IPI8 A0A2D4JI63 H3AVK0 F1S1V8 A0A3Q7S2A9 C1BIX4 G1LVU0 A0A384BSV4 A0A3Q7UIX3 A0A2U3XTJ5 A0A2U3VPK3 A0A384A7G1 A0A2I2U646 A0A091TTR5 A0A3Q7NWX5 A0A1U7SR99 Q9CZQ9 A0A091U941 L8J296 A0A1S3IPG7 U3IHD0 A0A3Q0D6T2 A0A2R9BWT6 K7CV40 A0A0S2Z626 Q8N3I7 A6QLF9 A0A2Y9FGN8 S4R8D7 H2P7R4 A0A2K5CK52 G1QY66 F7EG67 A0A091CX66 E0W305 F6VTH6 A0A287D381 A0A2I2ZW94 A0A2I0MIQ2 A0A341CTL4 A0A2Y9N2Q6 W5KEJ5 W5NZN3 A0A1V4K6I9 A0A2I0UTP7 A0A1S3ARM9 A0A091UUH3 B2RZ48 G1P0F6 A0A369RQE2 B3RQQ8 A0A2K6CE66 A0A2K6KG14 G7PKR7 A0A2K5Z6D8 A0A0D9RRT6 A0A096NZB9 A0A2K6NDM7 A0A2K5LNC6 H9Z224 Q4R649 A0A3L8SNI7 H0ZBX4 A0A340WUL5 G3T4E0 A0A093GWF7 H2MRS1 A0A3P8YYM9 A0A3B4DU96 A0A1W4Y7X3 A0A2T7PC08 A0A2K5QZH3 A0A1W4Z903 A0A2I2Z8B3 A0A3Q3J2R1 W5MN19 A0A2U3V9C2
Pubmed
19121390
28756777
26354079
22118469
26227816
18362917
+ More
19820115 28812685 24845553 18563158 29403074 23056606 22293439 23254933 27762356 9215903 30723633 20010809 24813606 17975172 16141072 19468303 15489334 15137946 21183079 22072986 22751099 23749191 26319212 22722832 16136131 26871637 17974005 15815621 16327777 17574030 24939912 18203199 21344540 19393038 25243066 20566863 18464734 22398555 23371554 25329095 20809919 15057822 15632090 21993624 30042472 18719581 22002653 25362486 25319552 30282656 20360741 17554307 25069045
19820115 28812685 24845553 18563158 29403074 23056606 22293439 23254933 27762356 9215903 30723633 20010809 24813606 17975172 16141072 19468303 15489334 15137946 21183079 22072986 22751099 23749191 26319212 22722832 16136131 26871637 17974005 15815621 16327777 17574030 24939912 18203199 21344540 19393038 25243066 20566863 18464734 22398555 23371554 25329095 20809919 15057822 15632090 21993624 30042472 18719581 22002653 25362486 25319552 30282656 20360741 17554307 25069045
EMBL
BABH01034340
RSAL01000020
RVE52595.1
ODYU01005753
SOQ46930.1
KZ149929
+ More
PZC77470.1 NWSH01000446 PCG76354.1 KQ460720 KPJ12659.1 AGBW02010443 OWR48509.1 KQ459356 KPJ01276.1 JTDY01000046 KOB79199.1 KQ971307 EFA11133.1 GEDC01010844 JAS26454.1 NEDP02076645 OWF36293.1 KK853380 KDR08011.1 GG666498 EEN62236.1 PYGN01000536 PSN44632.1 JX053304 AFK11532.1 AKHW03006853 KYO17879.1 KL217611 KFO97086.1 AMQN01000650 AMQN01000651 KB293808 ELU15448.1 HAAF01001615 CCP73441.1 BC135573 AAI35574.1 BC049492 CM004482 OCT63563.1 IACK01194711 LAA96198.1 AFYH01086348 AFYH01086349 AEMK02000100 DQIR01216396 DQIR01299388 HDB71873.1 BT074553 ACO08977.1 ACTA01160968 AANG04001482 KK465770 KFQ81754.1 AK012283 AL929083 BC061031 KK423653 KFQ87219.1 JH880354 ELR62348.1 ADON01068760 ADON01068761 ADON01068762 AJFE02085449 AACZ04058509 GABC01005217 GABF01005804 GABD01004585 GABE01002475 JAA06121.1 JAA16341.1 JAA28515.1 JAA42264.1 KU178857 ALQ34315.1 AY604003 AY604004 AL834305 AC093899 CH471058 BC044593 BC147950 AAI47951.1 ABGA01089908 ABGA01164215 ABGA01287064 ABGA01287065 ADFV01058422 ADFV01058423 ADFV01058424 GAMT01001034 GAMS01006680 GAMR01004684 GAMQ01004786 GAMP01009584 JAB10827.1 JAB16456.1 JAB29248.1 JAB37065.1 JAB43171.1 KN124048 KFO22480.1 DS235881 EEB20011.1 AGTP01035491 CABD030016933 CABD030016934 CABD030016935 CABD030016936 AKCR02000010 PKK29554.1 AMGL01052775 LSYS01004331 OPJ80024.1 KZ505638 PKU49431.1 KL410194 KFQ94629.1 AABR07052473 BC167024 CH473949 AAI67024.1 EDL79059.1 AAPE02004773 AAPE02004774 AAPE02004775 NOWV01000295 RDD36915.1 DS985243 EDV26742.1 CM001287 EHH54926.1 AQIB01011524 AQIB01011525 AQIB01011526 AQIB01011527 AQIB01011528 AQIB01011529 AQIB01011530 AQIB01011531 AQIB01011532 AHZZ02004088 AHZZ02004089 JU322139 JU473186 AFE65895.1 AFH29990.1 AB169341 QUSF01000012 RLW04973.1 ABQF01010526 KL216733 KFV71119.1 PZQS01000005 PVD30948.1 AHAT01020077
PZC77470.1 NWSH01000446 PCG76354.1 KQ460720 KPJ12659.1 AGBW02010443 OWR48509.1 KQ459356 KPJ01276.1 JTDY01000046 KOB79199.1 KQ971307 EFA11133.1 GEDC01010844 JAS26454.1 NEDP02076645 OWF36293.1 KK853380 KDR08011.1 GG666498 EEN62236.1 PYGN01000536 PSN44632.1 JX053304 AFK11532.1 AKHW03006853 KYO17879.1 KL217611 KFO97086.1 AMQN01000650 AMQN01000651 KB293808 ELU15448.1 HAAF01001615 CCP73441.1 BC135573 AAI35574.1 BC049492 CM004482 OCT63563.1 IACK01194711 LAA96198.1 AFYH01086348 AFYH01086349 AEMK02000100 DQIR01216396 DQIR01299388 HDB71873.1 BT074553 ACO08977.1 ACTA01160968 AANG04001482 KK465770 KFQ81754.1 AK012283 AL929083 BC061031 KK423653 KFQ87219.1 JH880354 ELR62348.1 ADON01068760 ADON01068761 ADON01068762 AJFE02085449 AACZ04058509 GABC01005217 GABF01005804 GABD01004585 GABE01002475 JAA06121.1 JAA16341.1 JAA28515.1 JAA42264.1 KU178857 ALQ34315.1 AY604003 AY604004 AL834305 AC093899 CH471058 BC044593 BC147950 AAI47951.1 ABGA01089908 ABGA01164215 ABGA01287064 ABGA01287065 ADFV01058422 ADFV01058423 ADFV01058424 GAMT01001034 GAMS01006680 GAMR01004684 GAMQ01004786 GAMP01009584 JAB10827.1 JAB16456.1 JAB29248.1 JAB37065.1 JAB43171.1 KN124048 KFO22480.1 DS235881 EEB20011.1 AGTP01035491 CABD030016933 CABD030016934 CABD030016935 CABD030016936 AKCR02000010 PKK29554.1 AMGL01052775 LSYS01004331 OPJ80024.1 KZ505638 PKU49431.1 KL410194 KFQ94629.1 AABR07052473 BC167024 CH473949 AAI67024.1 EDL79059.1 AAPE02004773 AAPE02004774 AAPE02004775 NOWV01000295 RDD36915.1 DS985243 EDV26742.1 CM001287 EHH54926.1 AQIB01011524 AQIB01011525 AQIB01011526 AQIB01011527 AQIB01011528 AQIB01011529 AQIB01011530 AQIB01011531 AQIB01011532 AHZZ02004088 AHZZ02004089 JU322139 JU473186 AFE65895.1 AFH29990.1 AB169341 QUSF01000012 RLW04973.1 ABQF01010526 KL216733 KFV71119.1 PZQS01000005 PVD30948.1 AHAT01020077
Proteomes
UP000005204
UP000283053
UP000218220
UP000053240
UP000007151
UP000053268
+ More
UP000037510 UP000007266 UP000242188 UP000027135 UP000001554 UP000245037 UP000050525 UP000054308 UP000014760 UP000000437 UP000186698 UP000248482 UP000008672 UP000008227 UP000286640 UP000008912 UP000261680 UP000291021 UP000286642 UP000245341 UP000245340 UP000261681 UP000011712 UP000286641 UP000189704 UP000000589 UP000085678 UP000016666 UP000189706 UP000240080 UP000002277 UP000005640 UP000009136 UP000248484 UP000245300 UP000001595 UP000233020 UP000001073 UP000008225 UP000028990 UP000009046 UP000002279 UP000005215 UP000001519 UP000053872 UP000252040 UP000248483 UP000018467 UP000002356 UP000190648 UP000079721 UP000053283 UP000002494 UP000001074 UP000253843 UP000009022 UP000233120 UP000233180 UP000009130 UP000233140 UP000029965 UP000028761 UP000233200 UP000233060 UP000233100 UP000276834 UP000007754 UP000265300 UP000007646 UP000053875 UP000001038 UP000265140 UP000261440 UP000192224 UP000245119 UP000233040 UP000261600 UP000018468 UP000245320
UP000037510 UP000007266 UP000242188 UP000027135 UP000001554 UP000245037 UP000050525 UP000054308 UP000014760 UP000000437 UP000186698 UP000248482 UP000008672 UP000008227 UP000286640 UP000008912 UP000261680 UP000291021 UP000286642 UP000245341 UP000245340 UP000261681 UP000011712 UP000286641 UP000189704 UP000000589 UP000085678 UP000016666 UP000189706 UP000240080 UP000002277 UP000005640 UP000009136 UP000248484 UP000245300 UP000001595 UP000233020 UP000001073 UP000008225 UP000028990 UP000009046 UP000002279 UP000005215 UP000001519 UP000053872 UP000252040 UP000248483 UP000018467 UP000002356 UP000190648 UP000079721 UP000053283 UP000002494 UP000001074 UP000253843 UP000009022 UP000233120 UP000233180 UP000009130 UP000233140 UP000029965 UP000028761 UP000233200 UP000233060 UP000233100 UP000276834 UP000007754 UP000265300 UP000007646 UP000053875 UP000001038 UP000265140 UP000261440 UP000192224 UP000245119 UP000233040 UP000261600 UP000018468 UP000245320
Pfam
PF07289 BBL5
ProteinModelPortal
H9JGR5
A0A3S2NYX1
A0A2H1W1F4
A0A2W1BXD7
A0A2A4JXJ2
A0A0N1IFC5
+ More
A0A212F450 A0A0N1PGX0 A0A0L7LUY1 D6W797 A0A1B6DL88 A0A210PII7 A0A067QHW0 C3YBX4 A0A2P8YK66 K4FYP4 A0A151M038 A0A091HMF3 R7V9C2 U6CSK7 A4IHK9 Q7ZWB7 A0A1L8EW62 A0A2Y9IPI8 A0A2D4JI63 H3AVK0 F1S1V8 A0A3Q7S2A9 C1BIX4 G1LVU0 A0A384BSV4 A0A3Q7UIX3 A0A2U3XTJ5 A0A2U3VPK3 A0A384A7G1 A0A2I2U646 A0A091TTR5 A0A3Q7NWX5 A0A1U7SR99 Q9CZQ9 A0A091U941 L8J296 A0A1S3IPG7 U3IHD0 A0A3Q0D6T2 A0A2R9BWT6 K7CV40 A0A0S2Z626 Q8N3I7 A6QLF9 A0A2Y9FGN8 S4R8D7 H2P7R4 A0A2K5CK52 G1QY66 F7EG67 A0A091CX66 E0W305 F6VTH6 A0A287D381 A0A2I2ZW94 A0A2I0MIQ2 A0A341CTL4 A0A2Y9N2Q6 W5KEJ5 W5NZN3 A0A1V4K6I9 A0A2I0UTP7 A0A1S3ARM9 A0A091UUH3 B2RZ48 G1P0F6 A0A369RQE2 B3RQQ8 A0A2K6CE66 A0A2K6KG14 G7PKR7 A0A2K5Z6D8 A0A0D9RRT6 A0A096NZB9 A0A2K6NDM7 A0A2K5LNC6 H9Z224 Q4R649 A0A3L8SNI7 H0ZBX4 A0A340WUL5 G3T4E0 A0A093GWF7 H2MRS1 A0A3P8YYM9 A0A3B4DU96 A0A1W4Y7X3 A0A2T7PC08 A0A2K5QZH3 A0A1W4Z903 A0A2I2Z8B3 A0A3Q3J2R1 W5MN19 A0A2U3V9C2
A0A212F450 A0A0N1PGX0 A0A0L7LUY1 D6W797 A0A1B6DL88 A0A210PII7 A0A067QHW0 C3YBX4 A0A2P8YK66 K4FYP4 A0A151M038 A0A091HMF3 R7V9C2 U6CSK7 A4IHK9 Q7ZWB7 A0A1L8EW62 A0A2Y9IPI8 A0A2D4JI63 H3AVK0 F1S1V8 A0A3Q7S2A9 C1BIX4 G1LVU0 A0A384BSV4 A0A3Q7UIX3 A0A2U3XTJ5 A0A2U3VPK3 A0A384A7G1 A0A2I2U646 A0A091TTR5 A0A3Q7NWX5 A0A1U7SR99 Q9CZQ9 A0A091U941 L8J296 A0A1S3IPG7 U3IHD0 A0A3Q0D6T2 A0A2R9BWT6 K7CV40 A0A0S2Z626 Q8N3I7 A6QLF9 A0A2Y9FGN8 S4R8D7 H2P7R4 A0A2K5CK52 G1QY66 F7EG67 A0A091CX66 E0W305 F6VTH6 A0A287D381 A0A2I2ZW94 A0A2I0MIQ2 A0A341CTL4 A0A2Y9N2Q6 W5KEJ5 W5NZN3 A0A1V4K6I9 A0A2I0UTP7 A0A1S3ARM9 A0A091UUH3 B2RZ48 G1P0F6 A0A369RQE2 B3RQQ8 A0A2K6CE66 A0A2K6KG14 G7PKR7 A0A2K5Z6D8 A0A0D9RRT6 A0A096NZB9 A0A2K6NDM7 A0A2K5LNC6 H9Z224 Q4R649 A0A3L8SNI7 H0ZBX4 A0A340WUL5 G3T4E0 A0A093GWF7 H2MRS1 A0A3P8YYM9 A0A3B4DU96 A0A1W4Y7X3 A0A2T7PC08 A0A2K5QZH3 A0A1W4Z903 A0A2I2Z8B3 A0A3Q3J2R1 W5MN19 A0A2U3V9C2
Ontologies
KEGG
GO
PANTHER
Topology
Subcellular location
Cell projection
Cilium membrane
Cytoplasm
Cytoskeleton
Microtubule organizing center
Centrosome
Centriolar satellite
Cilium basal body
Cilium membrane
Cytoplasm
Cytoskeleton
Microtubule organizing center
Centrosome
Centriolar satellite
Cilium basal body
Length:
346
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.02837
Exp number, first 60 AAs:
0.00253
Total prob of N-in:
0.02918
outside
1 - 346
Population Genetic Test Statistics
Pi
181.78399
Theta
164.562603
Tajima's D
0.215632
CLR
0.733132
CSRT
0.43732813359332
Interpretation
Uncertain
