SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04139
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.535 Nuclear   Reliability : 1.862
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAAATTTGAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCTTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATATAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCCTCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGAACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKNLNITKRFVYRTIKRYNEDSSVDDRSRSGRLRSVRTPAVIKAVKARIQRNPKQESYNKQNDKVYAHSSEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAVVYQNIVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPPPNLESLKTSLIKAAADIDMNLVRAAIDDWPRRLKACIQNHGGHFE

Summary

Similarity
Belongs to the TGF-beta family.
Pfam
PF00019   TGF_beta        + More
PF13358   DDE_3
PF00292   PAX
Interpro
IPR001839   TGF-b_C        + More
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR009057   Homeobox-like_sf       
IPR036388   WH-like_DNA-bd_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
SUPFAM
SSF57501   SSF57501        + More
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=6.16964e-12,     Score=169

Ontologies

Topology

Subcellular location
Secreted  
Length:
271
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.24646
Exp number, first 60 AAs:
0.95623
Total prob of N-in:
0.08682
outside
1  -  271
 
 

Population Genetic Test Statistics

Pi
138.980068
Theta
57.684828
Tajima's D
2.560437
CLR
0.411667
CSRT
0.949502524873756
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号