SGID The Silkworm Genome Information Database
Gene
KWMTBOMO03915
Pre Gene Modal
BGIBMGA010156
Annotation
putative_cytoplasmic_dynein_light_chain_[Danaus_plexippus]
Full name
Dynein light chain Tctex-type 1      
Alternative Name
Activator of G-protein signaling 2
T-complex testis-specific protein 1 homolog
Protein CW-1
Location in the cell
Cytoplasmic   Reliability : 1.04 Nuclear   Reliability : 1.554
 

Sequence

CDS
ATGGCTCAAGAGGATGACGAAGAGGATTTAACATTTAACGTCGATGAAGTGCAACAGATAGTAAGAGACAATGTAGAGTTGTGTTTGGGCGGGAACGCTTATAGTCACTCAAGAACGCCACAGTGGATAACTATAATCACAGAGAAGACCTTAGCTCGATTGAATAAATTAAACAAGCCTTACAAATATATCATGAGAATTACCATAACTCAGAAGAATGGTTCCGGTTTGCATACAGCCGCTGCGTACTACTGGGACATCGCTACAGATGGCACGTGCACAGTGCGTTGGGAAAATAAGTACATGTATTGCATTGTGAATATATGGGCGCTTGCTCTTCAAATATAG
Protein
MAQEDDEEDLTFNVDEVQQIVRDNVELCLGGNAYSHSRTPQWITIITEKTLARLNKLNKPYKYIMRITITQKNGSGLHTAAAYYWDIATDGTCTVRWENKYMYCIVNIWALALQI

Summary

Description
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site. May also be a accessory component of axonemal dynein (By similarity).
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. Required for neurite outgrowth. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (By similarity). Involved in the regulation of mitotic spindle orientation.
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation (By similarity). Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (PubMed:27502274).
(Microbial infection) Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site.
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. May also be a accessory component of axonemal dynein (By similarity).
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation. Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (By similarity).
Subunit
Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and dynein LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with RHO. Interacts with DYNC1I1 and DYNC1I2 (By similarity). Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2 (By similarity). Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma. Interacts with ACVR2B and ARHGEF2 (By similarity).
Homodimer (Probable). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with DYNC1I1 and DYNC1I2. Interacts with RHO. Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2. Interacts with BMPR2. Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma (By similarity). Interacts with ACVR2B and ARHGEF2.
(Microbial infection) Interacts with human papillomavirus 16 L2 protein; this interaction is essential for virus intracellular transport during entry.
(Microbial infection) Interacts with Mason-Pfizer monkey virus protein Gag.
Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with RHO. Interacts with DYNC1I1 and DYNC1I2. Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2. Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma. Interacts with ACVR2B and ARHGEF2 (By similarity).
Similarity
Belongs to the dynein light chain Tctex-type family.
Keywords
Acetylation   Cell cycle   Cell division   Complete proteome   Cytoplasm   Cytoskeleton   Dynein   Golgi apparatus   Microtubule   Mitosis   Motor protein   Neurogenesis   Phosphoprotein   Reference proteome   Transport   3D-structure   Cytoplasmic inwards viral transport   Host-virus interaction   Microtubular inwards viral transport   Virus entry into host cell  
Feature
chain  Dynein light chain Tctex-type 1
EMBL
BABH01011500    BABH01011501    AGBW02014441    OWR41671.1    KZ149942    PZC76897.1    + More
KQ460930    KPJ10808.1    ODYU01008168    SOQ51547.1    NNAY01004450    OXU17884.1    AAZX01002871    AGTO01000028    QOIP01000011    RLU17062.1    ABQF01014400    DQ213546    ACH43825.1    KQ414714    KOC62935.1    AAPE02055523    AAPE02027514    AAPE02027515    LSYS01006902    OPJ72955.1    KL218240    KFP03240.1    BC166879    CH474077    AAI66879.1    EDL83717.1    AB010119    AJ131437    KE667722    ERE85017.1    AGTP01022032    AADN05000003    HAAF01000172    CCP71998.1    AAQR03090280    CM004474    OCT80233.1    BC088060    AAH88060.1    GL888613    EGI59031.1    AQIA01050453    AQIA01050454    CABD030048689    ACTA01088951    ACTA01096951    ACTA01104951    AHZZ02025476    AANG04000169    ABGA01178679    NDHI03003369    PNJ79161.1    AACZ04028794    AACZ04028795    GABF01010101    GABD01010803    NBAG03000358    JAA12044.1    JAA22297.1    PNI35447.1    GAMT01009353    GAMS01010252    GAMR01007952    GAMQ01003517    GAMP01010561    JAB02508.1    JAB12884.1    JAB25980.1    JAB38334.1    JAB42194.1    JSUE03031804    CM001256    EHH18579.1    U56255    D50663    EU862237    AK315601    CR456931    AL591025    AL589931    CH471051    BC029412    BC105588    AF067370    BC108160    KQ976439    KYM86661.1    ADTU01024182    KQ982409    KYQ56774.1    AAGW02053281    AEMK02000001    FJ487632    DQIR01075246    DQIR01166945    DQIR01292516    ACL27890.1    HDA30722.1    HDB22422.1    KE164845    EPQ20492.1    FR904982    CDQ74558.1    AQIB01073068    AAPE02018172    NOWV01000012    RDD45895.1    DS985245    EDV25012.1    KK466939    KFQ82404.1    KK719263    KFO62463.1    KL468928    KFV18052.1    KK430268    KFQ88832.1    KL410062    KFQ93608.1    KK507335    KFP61824.1    KL423794    KFW89704.1    KK735008    KFR11881.1    KL330642    KFP57844.1    KK502094    KFP20492.1    KL871168    KGL91102.1    KL376951    KFP84599.1    KL224787    KFW63705.1    KK655091    KFQ04352.1    KL226140    KFM08982.1    GABE01010927    JAA33812.1    AGCU01032638    AGCU01032639    JH169546    GEBF01006930    EHB07035.1    JAN96702.1    AHAT01015758   
Pfam
PF03645   Tctex-1
Interpro
IPR038586   Tctex-1-like_sf        + More
IPR005334   Tctex-1-like       
Gene 3D
PDB
5WI4     E-value=7.52731e-32,     Score=336

Ontologies

Topology

Subcellular location
Golgi apparatus   Localizes to mitotic spindles.   With evidence from 1 publications.
Cytoplasm   Localizes to mitotic spindles.   With evidence from 1 publications.
Cytoskeleton   Localizes to mitotic spindles.   With evidence from 1 publications.
Spindle   Localizes to mitotic spindles.   With evidence from 1 publications.
Length:
115
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.04494
Exp number, first 60 AAs:
0.0027
Total prob of N-in:
0.16252
outside
1  -  115
 
 

Population Genetic Test Statistics

Pi
260.183624
Theta
158.455255
Tajima's D
1.920653
CLR
0.806738
CSRT
0.871556422178891
Interpretation
Uncertain
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号

渝公网安备 50010602502065号