Gene
KWMTBOMO03915
Pre Gene Modal
BGIBMGA010156
Annotation
putative_cytoplasmic_dynein_light_chain_[Danaus_plexippus]
Full name
Dynein light chain Tctex-type 1
Alternative Name
Activator of G-protein signaling 2
T-complex testis-specific protein 1 homolog
Protein CW-1
T-complex testis-specific protein 1 homolog
Protein CW-1
Location in the cell
Cytoplasmic Reliability : 1.04 Nuclear Reliability : 1.554
Sequence
CDS
ATGGCTCAAGAGGATGACGAAGAGGATTTAACATTTAACGTCGATGAAGTGCAACAGATAGTAAGAGACAATGTAGAGTTGTGTTTGGGCGGGAACGCTTATAGTCACTCAAGAACGCCACAGTGGATAACTATAATCACAGAGAAGACCTTAGCTCGATTGAATAAATTAAACAAGCCTTACAAATATATCATGAGAATTACCATAACTCAGAAGAATGGTTCCGGTTTGCATACAGCCGCTGCGTACTACTGGGACATCGCTACAGATGGCACGTGCACAGTGCGTTGGGAAAATAAGTACATGTATTGCATTGTGAATATATGGGCGCTTGCTCTTCAAATATAG
Protein
MAQEDDEEDLTFNVDEVQQIVRDNVELCLGGNAYSHSRTPQWITIITEKTLARLNKLNKPYKYIMRITITQKNGSGLHTAAAYYWDIATDGTCTVRWENKYMYCIVNIWALALQI
Summary
Description
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site. May also be a accessory component of axonemal dynein (By similarity).
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. Required for neurite outgrowth. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (By similarity). Involved in the regulation of mitotic spindle orientation.
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation (By similarity). Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (PubMed:27502274).
(Microbial infection) Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site.
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. May also be a accessory component of axonemal dynein (By similarity).
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation. Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (By similarity).
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. Required for neurite outgrowth. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (By similarity). Involved in the regulation of mitotic spindle orientation.
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation (By similarity). Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (PubMed:27502274).
(Microbial infection) Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site.
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. May also be a accessory component of axonemal dynein (By similarity).
Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation. Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (By similarity).
Subunit
Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and dynein LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with RHO. Interacts with DYNC1I1 and DYNC1I2 (By similarity). Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2 (By similarity). Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma. Interacts with ACVR2B and ARHGEF2 (By similarity).
Homodimer (Probable). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with DYNC1I1 and DYNC1I2. Interacts with RHO. Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2. Interacts with BMPR2. Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma (By similarity). Interacts with ACVR2B and ARHGEF2.
(Microbial infection) Interacts with human papillomavirus 16 L2 protein; this interaction is essential for virus intracellular transport during entry.
(Microbial infection) Interacts with Mason-Pfizer monkey virus protein Gag.
Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with RHO. Interacts with DYNC1I1 and DYNC1I2. Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2. Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma. Interacts with ACVR2B and ARHGEF2 (By similarity).
Homodimer (Probable). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with DYNC1I1 and DYNC1I2. Interacts with RHO. Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2. Interacts with BMPR2. Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma (By similarity). Interacts with ACVR2B and ARHGEF2.
(Microbial infection) Interacts with human papillomavirus 16 L2 protein; this interaction is essential for virus intracellular transport during entry.
(Microbial infection) Interacts with Mason-Pfizer monkey virus protein Gag.
Homodimer (By similarity). The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. DYNLT1 and DYNLT3 compete for association with dynein IC (DYNC1I1 or DYNC1I2). Self-associates. Interacts with RHO. Interacts with DYNC1I1 and DYNC1I2. Interacts with DOC2A, DOC2B and SCN10A. Interacts with PVR. Interacts with SVIL isoform 2. Interacts with GNB1; the interaction occurs in presence of guanine nucleotide-binding protein G(T) subunit gamma; the interaction diminishes the association of DYNLT1 with dynein IC (DYNC1I1 or DYNC1I2). Interacts with GNB2, GNB3 and GNB5; the interactions occur in presence of guanine nucleotide-binding protein G(T) subunit gamma. Interacts with ACVR2B and ARHGEF2 (By similarity).
Similarity
Belongs to the dynein light chain Tctex-type family.
Keywords
Acetylation
Cell cycle
Cell division
Complete proteome
Cytoplasm
Cytoskeleton
Dynein
Golgi apparatus
Microtubule
Mitosis
Motor protein
Neurogenesis
Phosphoprotein
Reference proteome
Transport
3D-structure
Cytoplasmic inwards viral transport
Host-virus interaction
Microtubular inwards viral transport
Virus entry into host cell
Feature
chain Dynein light chain Tctex-type 1
Uniprot
H9JKV5
A0A212EJM6
A0A2W1BUM8
A0A194QZ44
A0A2H1WEV3
A0A088A3Y0
+ More
A0A232EHR8 K7JBH0 U3KDS0 A0A3L8DA93 B5FXR4 A0A0L7QWG0 G1QEA5 G1NWN1 A0A1S3FTW8 A0A2K5BXI7 A0A1V4JLN3 A0A091I766 B2RYR9 Q9Z336 A0A061IGM0 I3M7J8 F6XFJ1 G1NJP7 A0A3Q2U8X6 F7C5B9 U6CQY4 H0WGJ1 A0A1L8G8P0 Q5I0R5 F4X3E0 A0A2K6CT01 A0A2K6MQ01 A0A2K5V8A7 A0A2I2YU98 G1LSC2 A0A2K5X9R9 A0A2Y9D6S4 A0A096NRM7 A0A2K5C042 A0A2K6QCW4 M3W8R7 A0A2K5NNH3 A0A2Y9KZC5 A0A3Q7UMW1 A0A2K5H9U8 A0A2K5S446 A0A2K6TCJ8 A0A2K6F1R6 A0A3Q7W7R8 H2PKR1 H2QTZ1 F7F2V6 F6QZS9 P63172 P63171 A0A195BN83 A0A158NRM7 A0A151X8W7 A0A1U7QH56 G1T4I7 A0A3Q7NM01 A0A340XR55 A0A2Y9SIJ9 A0A2Y9HBM1 A0A2U3Y5Z0 A0A2Y9MFM3 A0A2U3X3T4 A0A384AFP3 B8Y650 S7QGJ1 S4RI54 A0A060X4L8 A0A1S3S9U5 A0A0D9RKC6 A0A3Q3FIZ1 G1Q585 A0A369SG52 B3RYC2 A0A091TVF8 A0A091EX34 A0A1S2ZA83 A0A093D0K3 A0A091UFA5 A0A091VVB0 A0A091LU38 A0A093T508 A0A091XF47 A0A091LMU6 A0A091JIU7 A0A0A0AB13 A0A091N6U7 A0A093NP08 A0A091P8U7 A0A087R678 K7DHM7 K7GHX6 A0A341BLR5 G5BCM4 W5NHE3
A0A232EHR8 K7JBH0 U3KDS0 A0A3L8DA93 B5FXR4 A0A0L7QWG0 G1QEA5 G1NWN1 A0A1S3FTW8 A0A2K5BXI7 A0A1V4JLN3 A0A091I766 B2RYR9 Q9Z336 A0A061IGM0 I3M7J8 F6XFJ1 G1NJP7 A0A3Q2U8X6 F7C5B9 U6CQY4 H0WGJ1 A0A1L8G8P0 Q5I0R5 F4X3E0 A0A2K6CT01 A0A2K6MQ01 A0A2K5V8A7 A0A2I2YU98 G1LSC2 A0A2K5X9R9 A0A2Y9D6S4 A0A096NRM7 A0A2K5C042 A0A2K6QCW4 M3W8R7 A0A2K5NNH3 A0A2Y9KZC5 A0A3Q7UMW1 A0A2K5H9U8 A0A2K5S446 A0A2K6TCJ8 A0A2K6F1R6 A0A3Q7W7R8 H2PKR1 H2QTZ1 F7F2V6 F6QZS9 P63172 P63171 A0A195BN83 A0A158NRM7 A0A151X8W7 A0A1U7QH56 G1T4I7 A0A3Q7NM01 A0A340XR55 A0A2Y9SIJ9 A0A2Y9HBM1 A0A2U3Y5Z0 A0A2Y9MFM3 A0A2U3X3T4 A0A384AFP3 B8Y650 S7QGJ1 S4RI54 A0A060X4L8 A0A1S3S9U5 A0A0D9RKC6 A0A3Q3FIZ1 G1Q585 A0A369SG52 B3RYC2 A0A091TVF8 A0A091EX34 A0A1S2ZA83 A0A093D0K3 A0A091UFA5 A0A091VVB0 A0A091LU38 A0A093T508 A0A091XF47 A0A091LMU6 A0A091JIU7 A0A0A0AB13 A0A091N6U7 A0A093NP08 A0A091P8U7 A0A087R678 K7DHM7 K7GHX6 A0A341BLR5 G5BCM4 W5NHE3
Pubmed
19121390
22118469
28756777
26354079
28648823
20075255
+ More
30249741 17018643 20360741 21993624 15489334 15632090 9804756 11746667 12591166 15992542 17491591 23929341 19892987 20838655 15592404 18464734 27762356 21719571 22398555 20010809 25362486 17975172 16136131 25243066 17431167 22002653 8646886 14702039 14574404 11751937 14583445 15194795 16880273 17965411 18647839 19413330 21269460 21166973 22223895 25944712 27502274 9677391 11425878 11967380 16956385 21347285 30723633 24755649 30042472 18719581 17381049 21993625
30249741 17018643 20360741 21993624 15489334 15632090 9804756 11746667 12591166 15992542 17491591 23929341 19892987 20838655 15592404 18464734 27762356 21719571 22398555 20010809 25362486 17975172 16136131 25243066 17431167 22002653 8646886 14702039 14574404 11751937 14583445 15194795 16880273 17965411 18647839 19413330 21269460 21166973 22223895 25944712 27502274 9677391 11425878 11967380 16956385 21347285 30723633 24755649 30042472 18719581 17381049 21993625
EMBL
BABH01011500
BABH01011501
AGBW02014441
OWR41671.1
KZ149942
PZC76897.1
+ More
KQ460930 KPJ10808.1 ODYU01008168 SOQ51547.1 NNAY01004450 OXU17884.1 AAZX01002871 AGTO01000028 QOIP01000011 RLU17062.1 ABQF01014400 DQ213546 ACH43825.1 KQ414714 KOC62935.1 AAPE02055523 AAPE02027514 AAPE02027515 LSYS01006902 OPJ72955.1 KL218240 KFP03240.1 BC166879 CH474077 AAI66879.1 EDL83717.1 AB010119 AJ131437 KE667722 ERE85017.1 AGTP01022032 AADN05000003 HAAF01000172 CCP71998.1 AAQR03090280 CM004474 OCT80233.1 BC088060 AAH88060.1 GL888613 EGI59031.1 AQIA01050453 AQIA01050454 CABD030048689 ACTA01088951 ACTA01096951 ACTA01104951 AHZZ02025476 AANG04000169 ABGA01178679 NDHI03003369 PNJ79161.1 AACZ04028794 AACZ04028795 GABF01010101 GABD01010803 NBAG03000358 JAA12044.1 JAA22297.1 PNI35447.1 GAMT01009353 GAMS01010252 GAMR01007952 GAMQ01003517 GAMP01010561 JAB02508.1 JAB12884.1 JAB25980.1 JAB38334.1 JAB42194.1 JSUE03031804 CM001256 EHH18579.1 U56255 D50663 EU862237 AK315601 CR456931 AL591025 AL589931 CH471051 BC029412 BC105588 AF067370 BC108160 KQ976439 KYM86661.1 ADTU01024182 KQ982409 KYQ56774.1 AAGW02053281 AEMK02000001 FJ487632 DQIR01075246 DQIR01166945 DQIR01292516 ACL27890.1 HDA30722.1 HDB22422.1 KE164845 EPQ20492.1 FR904982 CDQ74558.1 AQIB01073068 AAPE02018172 NOWV01000012 RDD45895.1 DS985245 EDV25012.1 KK466939 KFQ82404.1 KK719263 KFO62463.1 KL468928 KFV18052.1 KK430268 KFQ88832.1 KL410062 KFQ93608.1 KK507335 KFP61824.1 KL423794 KFW89704.1 KK735008 KFR11881.1 KL330642 KFP57844.1 KK502094 KFP20492.1 KL871168 KGL91102.1 KL376951 KFP84599.1 KL224787 KFW63705.1 KK655091 KFQ04352.1 KL226140 KFM08982.1 GABE01010927 JAA33812.1 AGCU01032638 AGCU01032639 JH169546 GEBF01006930 EHB07035.1 JAN96702.1 AHAT01015758
KQ460930 KPJ10808.1 ODYU01008168 SOQ51547.1 NNAY01004450 OXU17884.1 AAZX01002871 AGTO01000028 QOIP01000011 RLU17062.1 ABQF01014400 DQ213546 ACH43825.1 KQ414714 KOC62935.1 AAPE02055523 AAPE02027514 AAPE02027515 LSYS01006902 OPJ72955.1 KL218240 KFP03240.1 BC166879 CH474077 AAI66879.1 EDL83717.1 AB010119 AJ131437 KE667722 ERE85017.1 AGTP01022032 AADN05000003 HAAF01000172 CCP71998.1 AAQR03090280 CM004474 OCT80233.1 BC088060 AAH88060.1 GL888613 EGI59031.1 AQIA01050453 AQIA01050454 CABD030048689 ACTA01088951 ACTA01096951 ACTA01104951 AHZZ02025476 AANG04000169 ABGA01178679 NDHI03003369 PNJ79161.1 AACZ04028794 AACZ04028795 GABF01010101 GABD01010803 NBAG03000358 JAA12044.1 JAA22297.1 PNI35447.1 GAMT01009353 GAMS01010252 GAMR01007952 GAMQ01003517 GAMP01010561 JAB02508.1 JAB12884.1 JAB25980.1 JAB38334.1 JAB42194.1 JSUE03031804 CM001256 EHH18579.1 U56255 D50663 EU862237 AK315601 CR456931 AL591025 AL589931 CH471051 BC029412 BC105588 AF067370 BC108160 KQ976439 KYM86661.1 ADTU01024182 KQ982409 KYQ56774.1 AAGW02053281 AEMK02000001 FJ487632 DQIR01075246 DQIR01166945 DQIR01292516 ACL27890.1 HDA30722.1 HDB22422.1 KE164845 EPQ20492.1 FR904982 CDQ74558.1 AQIB01073068 AAPE02018172 NOWV01000012 RDD45895.1 DS985245 EDV25012.1 KK466939 KFQ82404.1 KK719263 KFO62463.1 KL468928 KFV18052.1 KK430268 KFQ88832.1 KL410062 KFQ93608.1 KK507335 KFP61824.1 KL423794 KFW89704.1 KK735008 KFR11881.1 KL330642 KFP57844.1 KK502094 KFP20492.1 KL871168 KGL91102.1 KL376951 KFP84599.1 KL224787 KFW63705.1 KK655091 KFQ04352.1 KL226140 KFM08982.1 GABE01010927 JAA33812.1 AGCU01032638 AGCU01032639 JH169546 GEBF01006930 EHB07035.1 JAN96702.1 AHAT01015758
Proteomes
UP000005204
UP000007151
UP000053240
UP000005203
UP000215335
UP000002358
+ More
UP000016665 UP000279307 UP000007754 UP000053825 UP000001074 UP000081671 UP000233020 UP000190648 UP000054308 UP000002494 UP000030759 UP000005215 UP000002281 UP000001645 UP000000539 UP000002279 UP000005225 UP000186698 UP000007755 UP000233120 UP000233180 UP000233100 UP000001519 UP000008912 UP000233140 UP000248480 UP000028761 UP000233200 UP000011712 UP000233060 UP000248482 UP000286640 UP000233080 UP000233040 UP000233220 UP000233160 UP000286642 UP000001595 UP000002277 UP000006718 UP000005640 UP000009136 UP000078540 UP000005205 UP000075809 UP000189706 UP000001811 UP000286641 UP000265300 UP000248484 UP000248481 UP000245341 UP000248483 UP000245340 UP000261681 UP000008227 UP000245300 UP000193380 UP000087266 UP000029965 UP000261660 UP000253843 UP000009022 UP000052976 UP000079721 UP000053283 UP000053605 UP000053119 UP000053858 UP000054081 UP000053286 UP000007267 UP000252040 UP000006813 UP000018468
UP000016665 UP000279307 UP000007754 UP000053825 UP000001074 UP000081671 UP000233020 UP000190648 UP000054308 UP000002494 UP000030759 UP000005215 UP000002281 UP000001645 UP000000539 UP000002279 UP000005225 UP000186698 UP000007755 UP000233120 UP000233180 UP000233100 UP000001519 UP000008912 UP000233140 UP000248480 UP000028761 UP000233200 UP000011712 UP000233060 UP000248482 UP000286640 UP000233080 UP000233040 UP000233220 UP000233160 UP000286642 UP000001595 UP000002277 UP000006718 UP000005640 UP000009136 UP000078540 UP000005205 UP000075809 UP000189706 UP000001811 UP000286641 UP000265300 UP000248484 UP000248481 UP000245341 UP000248483 UP000245340 UP000261681 UP000008227 UP000245300 UP000193380 UP000087266 UP000029965 UP000261660 UP000253843 UP000009022 UP000052976 UP000079721 UP000053283 UP000053605 UP000053119 UP000053858 UP000054081 UP000053286 UP000007267 UP000252040 UP000006813 UP000018468
Pfam
PF03645 Tctex-1
Gene 3D
ProteinModelPortal
H9JKV5
A0A212EJM6
A0A2W1BUM8
A0A194QZ44
A0A2H1WEV3
A0A088A3Y0
+ More
A0A232EHR8 K7JBH0 U3KDS0 A0A3L8DA93 B5FXR4 A0A0L7QWG0 G1QEA5 G1NWN1 A0A1S3FTW8 A0A2K5BXI7 A0A1V4JLN3 A0A091I766 B2RYR9 Q9Z336 A0A061IGM0 I3M7J8 F6XFJ1 G1NJP7 A0A3Q2U8X6 F7C5B9 U6CQY4 H0WGJ1 A0A1L8G8P0 Q5I0R5 F4X3E0 A0A2K6CT01 A0A2K6MQ01 A0A2K5V8A7 A0A2I2YU98 G1LSC2 A0A2K5X9R9 A0A2Y9D6S4 A0A096NRM7 A0A2K5C042 A0A2K6QCW4 M3W8R7 A0A2K5NNH3 A0A2Y9KZC5 A0A3Q7UMW1 A0A2K5H9U8 A0A2K5S446 A0A2K6TCJ8 A0A2K6F1R6 A0A3Q7W7R8 H2PKR1 H2QTZ1 F7F2V6 F6QZS9 P63172 P63171 A0A195BN83 A0A158NRM7 A0A151X8W7 A0A1U7QH56 G1T4I7 A0A3Q7NM01 A0A340XR55 A0A2Y9SIJ9 A0A2Y9HBM1 A0A2U3Y5Z0 A0A2Y9MFM3 A0A2U3X3T4 A0A384AFP3 B8Y650 S7QGJ1 S4RI54 A0A060X4L8 A0A1S3S9U5 A0A0D9RKC6 A0A3Q3FIZ1 G1Q585 A0A369SG52 B3RYC2 A0A091TVF8 A0A091EX34 A0A1S2ZA83 A0A093D0K3 A0A091UFA5 A0A091VVB0 A0A091LU38 A0A093T508 A0A091XF47 A0A091LMU6 A0A091JIU7 A0A0A0AB13 A0A091N6U7 A0A093NP08 A0A091P8U7 A0A087R678 K7DHM7 K7GHX6 A0A341BLR5 G5BCM4 W5NHE3
A0A232EHR8 K7JBH0 U3KDS0 A0A3L8DA93 B5FXR4 A0A0L7QWG0 G1QEA5 G1NWN1 A0A1S3FTW8 A0A2K5BXI7 A0A1V4JLN3 A0A091I766 B2RYR9 Q9Z336 A0A061IGM0 I3M7J8 F6XFJ1 G1NJP7 A0A3Q2U8X6 F7C5B9 U6CQY4 H0WGJ1 A0A1L8G8P0 Q5I0R5 F4X3E0 A0A2K6CT01 A0A2K6MQ01 A0A2K5V8A7 A0A2I2YU98 G1LSC2 A0A2K5X9R9 A0A2Y9D6S4 A0A096NRM7 A0A2K5C042 A0A2K6QCW4 M3W8R7 A0A2K5NNH3 A0A2Y9KZC5 A0A3Q7UMW1 A0A2K5H9U8 A0A2K5S446 A0A2K6TCJ8 A0A2K6F1R6 A0A3Q7W7R8 H2PKR1 H2QTZ1 F7F2V6 F6QZS9 P63172 P63171 A0A195BN83 A0A158NRM7 A0A151X8W7 A0A1U7QH56 G1T4I7 A0A3Q7NM01 A0A340XR55 A0A2Y9SIJ9 A0A2Y9HBM1 A0A2U3Y5Z0 A0A2Y9MFM3 A0A2U3X3T4 A0A384AFP3 B8Y650 S7QGJ1 S4RI54 A0A060X4L8 A0A1S3S9U5 A0A0D9RKC6 A0A3Q3FIZ1 G1Q585 A0A369SG52 B3RYC2 A0A091TVF8 A0A091EX34 A0A1S2ZA83 A0A093D0K3 A0A091UFA5 A0A091VVB0 A0A091LU38 A0A093T508 A0A091XF47 A0A091LMU6 A0A091JIU7 A0A0A0AB13 A0A091N6U7 A0A093NP08 A0A091P8U7 A0A087R678 K7DHM7 K7GHX6 A0A341BLR5 G5BCM4 W5NHE3
PDB
5WI4
E-value=7.52731e-32,
Score=336
Ontologies
KEGG
GO
GO:0099503
GO:0005881
GO:0019060
GO:0043657
GO:0042802
GO:0005868
GO:0008022
GO:0006886
GO:0030027
GO:0044295
GO:0035795
GO:0051301
GO:0050768
GO:0035022
GO:0051493
GO:0008277
GO:0061564
GO:0005794
GO:0010976
GO:0000132
GO:0003774
GO:0048812
GO:0060548
GO:0005819
GO:0043025
GO:0005739
GO:0043087
GO:0016358
GO:1904813
GO:0043312
GO:0034774
GO:0005576
GO:0046718
GO:0075521
GO:0005874
GO:0043001
PANTHER
Topology
Subcellular location
Golgi apparatus
Localizes to mitotic spindles. With evidence from 1 publications.
Cytoplasm Localizes to mitotic spindles. With evidence from 1 publications.
Cytoskeleton Localizes to mitotic spindles. With evidence from 1 publications.
Spindle Localizes to mitotic spindles. With evidence from 1 publications.
Cytoplasm Localizes to mitotic spindles. With evidence from 1 publications.
Cytoskeleton Localizes to mitotic spindles. With evidence from 1 publications.
Spindle Localizes to mitotic spindles. With evidence from 1 publications.
Length:
115
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.04494
Exp number, first 60 AAs:
0.0027
Total prob of N-in:
0.16252
outside
1 - 115
Population Genetic Test Statistics
Pi
260.183624
Theta
158.455255
Tajima's D
1.920653
CLR
0.806738
CSRT
0.871556422178891
Interpretation
Uncertain
