SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03768
Pre Gene Modal
BGIBMGA010061
Annotation
PREDICTED:_trypsin?_alkaline_C-like_[Papilio_xuthus]
Full name
Trypsin, alkaline C       + More
Trypsin, alkaline A      
Trypsin, alkaline B      
Trypsin CFT-1      
Location in the cell
Extracellular   Reliability : 3.495
 

Sequence

CDS
ATGCCGAATTACGAGGTACCGGATAACCAGCCCGTCGTCCACGCCGGCTGGGGGGCCACAAGTCAAGGAGGCGAGGCGTCTGATGTACTTTTGGACGTCACAATCTACACTGTGAACAGGCAGTTATGCGCTGATAGATACTCCACCCTGGGTGATATTATAACCGAGAACATGATTTGCGCTGGTATTTTGGACGTGGGCGGCAAGGACGCCTGCCAAGGTGACTCTGGGGGTCCACTGTATTTCCATAACGTGCTTGTTGGTGTGGTTTCCTGGGGAGAAGGCTGCGCGAACAATACCTTCCCCGGAGTCAGTGCCGCGGTGTCTCCATACACTCAATGGATCGTCGACACGGCTGTTTAA
Protein
MPNYEVPDNQPVVHAGWGATSQGGEASDVLLDVTIYTVNRQLCADRYSTLGDIITENMICAGILDVGGKDACQGDSGGPLYFHNVLVGVVSWGEGCANNTFPGVSAAVSPYTQWIVDTAV

Summary

Catalytic Activity
Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.
Similarity
Belongs to the peptidase S1 family.
Keywords
Disulfide bond   Hydrolase   Protease   Secreted   Serine protease   Signal   Zymogen   Direct protein sequencing  
Feature
propeptide  Activation peptide
chain  Trypsin, alkaline C
EC Number
3.4.21.4
EMBL
BABH01024725    KQ459167    KPJ03461.1    KX951432    KY684226    ARR75600.1    + More
ASS33865.1    KR024671    ALE15213.1    AF261982    AAF74744.1    AF261981    AAF74743.1    KZ150010    PZC75087.1    NWSH01000631    PCG75147.1    EF600059    ABU98624.1    AY513650    AAR98919.1    PCG75146.1    PZC75088.1    JN793548    AFO68328.1    AY437836    AAR20817.1    FJ205440    ACR16004.1    GDQN01006776    JAT84278.1    GDQN01009270    JAT81784.1    AY587155    AAT95347.1    ODYU01002467    SOQ39998.1    KM083776    AIR09757.1    SOQ39997.1    JN793549    AFO68329.1    PCG75152.1    KPJ03458.1    AM690450    CAM84320.1    AF045138    AAC02216.1    ODYU01006115    SOQ47675.1    ODYU01007983    SOQ51222.1    JQ904129    AFM77759.1    AY587152    AAT95344.1    KPJ03460.1    AY587154    AAT95346.1    PZC75083.1    AF173498    AAF24228.1    EU673451    ACI45414.1    JTDY01004416    KOB68185.1    AF173497    AAF24227.1    AGBW02012089    OWR45697.1    RSAL01000013    RVE53438.1    FJ205433    ACR15999.2    JTDY01003642    KOB69233.1    AF261973    AAF74735.1    EU325549    ACB54939.1    AY587151    AAT95343.1    KY684221    ASS33860.1    KR024672    ALE15214.1    PCG75148.1    EF531638    ABR88249.1    MF770251    AXG72654.1    AY953065    AAX62038.1    RVE53439.1    AY953064    AY953068    AAX62037.1    AAX63384.1    JN410827    AEP25403.1    AF261975    AAF74737.1    AY587150    AAT95342.1    EF600053    ABU98618.1    PZC75086.1    AY953066    AAX62039.1    RSAL01000066    RVE49371.1    AY953059    AAX62032.1    HM535626    ADK66277.1    FJ205419    ADM35106.1    AY953061    AAX62034.1    AY513649    AAR98918.1    KPJ03459.1    AY953063    AAX62036.1    AY953060    AAX62033.1    KQ460409    KPJ14943.1    KQ458883    KPJ04582.1    BABH01007520    AY953062    AAX62035.1    RSAL01000038    RVE51124.1    KPJ03463.1    BABH01026286    JX312360    AFQ59994.1    KQ459933    KPJ19289.1    KC175562    AGR92345.1    L16807    JTDY01005557    KOB66887.1    JQ904122    AFM77752.1    KQ459597    KPI95068.1    KPI95066.1    GDQN01010607    GDQN01006137    JAT80447.1    JAT84917.1    L16805    JQ904125    AFM77755.1    BABH01007517    AY040819    AAK81696.1    KZ150104    PZC73452.1    AF064525    AF064526    AAC36247.1    AAC36248.1    JQ904123    AFM77753.1    L16806    ODYU01002419    SOQ39873.1    KPI95074.1    RVE51122.1    BABH01007473    U12917    AAA84423.1    L04749    JQ340915    AFP74111.1    ODYU01002655    SOQ40442.1    KZ149992    PZC75529.1   
Pfam
PF00089   Trypsin        + More
PF01365   RYDR_ITPR
PF02815   MIR
PF00520   Ion_trans
PF08709   Ins145_P3_rec
PF08454   RIH_assoc
Interpro
IPR033116   TRYPSIN_SER        + More
IPR001254   Trypsin_dom       
IPR009003   Peptidase_S1_PA       
IPR001314   Peptidase_S1A       
IPR018114   TRYPSIN_HIS       
IPR012224   Pept_S1A_FX       
IPR013662   RIH_assoc-dom       
IPR000699   RIH_dom       
IPR014821   Ins145_P3_rcpt       
IPR036300   MIR_dom_sf       
IPR035910   RyR/IP3R_RIH_dom_sf       
IPR005821   Ion_trans_dom       
IPR000493   InsP3_rcpt       
IPR016093   MIR_motif       
SUPFAM
SSF50494   SSF50494        + More
SSF82109   SSF82109       
SSF100909   SSF100909       
PDB
6O1G     E-value=1.55409e-19,     Score=229

Ontologies

Topology

Subcellular location
  
Length:
120
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.05779
Exp number, first 60 AAs:
0.01068
Total prob of N-in:
0.20762
outside
1  -  120
 
 

Population Genetic Test Statistics

Pi
168.13797
Theta
25.959047
Tajima's D
1.015622
CLR
6.824837
CSRT
0.669166541672916
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号