SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03657
Annotation
NA
Location in the cell
Nuclear   Reliability : 3.008
 

Sequence

CDS
ATGCCTCCTAAGAAGAATAATGATAATGACGAAAGAGAAGACGTTGAGATTCCACTTTGTGCTATTGTTGTTGAGAAGGACGAGATCAAAGAAGACTACAAGAAATTAAAAAAAGGAGATTACAAGAAGTTAGAGAAAGAAGATTACAAGAAGTTAGAAAAAGAAGACTGCAAGAAGTTGGTTAAAGTACCTTACCAGAATCATTTGACACAAAATAGAATACTGTACAAAGAGAAGAATGGAAGTAGTTTTATCGCTGTACCAAAGAAGATGGATAAAGAAATTAGAAGACAGAATTATAGGAGAGGTCGACTAAAAGTTGAAAATTGGGAATGGAGGAGGTCCGATACATACGACTAA
Protein
MPPKKNNDNDEREDVEIPLCAIVVEKDEIKEDYKKLKKGDYKKLEKEDYKKLEKEDCKKLVKVPYQNHLTQNRILYKEKNGSSFIAVPKKMDKEIRRQNYRRGRLKVENWEWRRSDTYD

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
119
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.44986
outside
1  -  119
 
 

Population Genetic Test Statistics

Pi
14.350251
Theta
26.559303
Tajima's D
-1.438451
CLR
10.756022
CSRT
0.0672466376681166
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号