SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03652
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.806 Nuclear   Reliability : 1.202
 

Sequence

CDS
ATGACCATTAACGCTGGCGTTCCACAAGGGTCGGTGCCCTACTCCACGCTTTTCATCCTGTATATCAATGATATGCTGTCTATTGATGGCATGTATTGCTATGCGGATGACAGCACGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGAAGCGTGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCAAATGGGGTGAATTGAAATTGGTTCAATTCAACCCGTTAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATAGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATTGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACGGAGCGAAGCGGTACTTCACGCCTGGACAAAGGCTTCTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCTCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCAGTCTCACGGATAGTTTGGAACCTCTGGGTCTGCGGAGGGACTTCGGTTCTCTCTGTATTTTATACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATAGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGATTCCAGAGATATTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCATGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCGGAGAGGTGGAGAGTATTAAGCGGTAA
Protein
MTINAGVPQGSVPYSTLFILYINDMLSIDGMYCYADDSTGDARYIGHQSLSRSVVQERRSKLVSEVENSLGRVSKWGELKLVQFNPLKTQVCAFTAKKDPFVIAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNGAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPSLTDSLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHSTARHRSRVHPYYLEPLRSSTVRFQRYFLPRTIRLWNELPSMVFPERYDMSFFKRGGEVESIKR

Summary

EMBL
AY359886    AAQ57129.1    RSAL01002067    RVE40593.1    RSAL01000487    RVE41561.1    + More
RSAL01000422    RVE41792.1    RSAL01003136    RVE40332.1    RSAL01000002    RVE54942.1    RSAL01000090    RVE48098.1    RVE55041.1    RVE55094.1    ODYU01002162    SOQ39302.1    RSAL01000164    RVE45343.1    GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    ODYU01007423    SOQ50184.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    LWDP01000391    ORD92879.1    GFAC01000919    JAT98269.1    GEFM01002324    JAP73472.1    GEGO01004433    JAR90971.1    GFAA01002657    JAU00778.1    GEFM01002394    JAP73402.1    GFAA01002479    JAU00956.1    GEGO01004630    JAR90774.1    GEFM01005882    JAP69914.1    GEGO01001118    JAR94286.1    GDRN01111277    JAI56804.1    GEFM01006417    JAP69379.1    GFAA01002514    JAU00921.1    GEGO01003794    JAR91610.1    GFAC01005646    JAT93542.1    GEFM01002419    JAP73377.1    GEGO01003312    JAR92092.1    GFAC01005665    JAT93523.1    GEFM01006421    JAP69375.1    GBIH01002577    JAC92133.1    GEGO01003111    JAR92293.1    NSIT01000218    PJE78268.1    LSMT01000297    PFX20951.1    NSIT01000412    PJE77717.1    GDRN01111334    JAI56796.1    MRZV01000639    PIK46517.1    FLMD02000154    SCV66010.1    GDRN01111278    JAI56803.1    GEGO01002473    JAR92931.1    GEGO01002794    JAR92610.1    FLMD02000280    SCV66640.1    GFAA01002385    JAU01050.1    GEGO01004295    JAR91109.1    GFAC01000861    JAT98327.1    NSIT01000239    PJE78188.1    GFAA01000066    JAU03369.1    NSIT01000538    PJE77518.1    GFAC01005670    JAT93518.1    GEGO01007438    JAR87966.1    PSZC01000087    PPJ25136.1    AGCU01040360    AGCU01117056    GADI01001229    JAA72579.1    AGCU01073976    AGCU01094663    JH815916    EKC31648.1    GEGO01004497    JAR90907.1    NSIT01000477    PJE77602.1    AGCU01160977    NSIT01000539    PJE77517.1    KZ505886    PKU43598.1    GEGO01002025    JAR93379.1    GFAA01003161    JAU00274.1    NEDP02004020    OWF47171.1    MRZV01001153    PIK40187.1    GFAC01005653    JAT93535.1    GEFM01005909    JAP69887.1    NSIT01000271    PJE78081.1    GFAA01002726    JAU00709.1    GEGO01003427    JAR91977.1    GFAC01007905    JAT91283.1    GEGO01003895    JAR91509.1    GANO01002501    JAB57370.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF04939   RRS1
PF01873   eIF-5_eIF-2B
PF08159   NUC153
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR007023   Ribosom_reg       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR028082   Peripla_BP_I       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF50978   SSF50978       
SSF53822   SSF53822       
Gene 3D

Ontologies

Topology

Length:
313
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.683099999999998
Exp number, first 60 AAs:
0.68263
Total prob of N-in:
0.04171
outside
1  -  313
 
 

Population Genetic Test Statistics

Pi
7.674071
Theta
5.92119
Tajima's D
0.724946
CLR
1.19385
CSRT
0.5985200739963
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号