SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03641
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.253
 

Sequence

CDS
ATGACAGGTCAAGAAGTGGTCGACGAAGAAGTGGTGGAAGACTTAGGGCTTCGGGCATATCGAAGAAAAACAGGACATCGTTTGAATGCTCGTCTAATGGACCTGAGACTGAAGAGATGCCGCGCTTTGTTGAAGCGGTACGCGGGAAAAAGATGTCGGGAAATTCTTTTTTCGGATGAAAAAATTTTTACCTTAGAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTTCAACGAGATCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACTATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAATAG
Protein
MTGQEVVDEEVVEDLGLRAYRRKTGHRLNARLMDLRLKRCRALLKRYAGKRCREILFSDEKIFTLEESYNKQNDKVYAHSSEEASNRIPRVQRDHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAVVYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEE

Summary

Similarity
Belongs to the TGF-beta family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    AB473770    BAH20555.1    KQ459680    KPJ20472.1    RSAL01000012    RVE53510.1    JF779677    AEO90418.1    RSAL01000021    RVE52408.1    U47917    AAB47739.1    RSAL01000140    RVE46091.1    RSAL01000063    RVE49524.1    RSAL01000016    RVE53060.1    RSAL01000133    RVE46339.1    RSAL01000022    RVE52367.1    RSAL01000144    RVE45972.1    LNIX01000030    OXA41211.1    RSAL01000431    RVE41742.1    UYSL01019905    VDL71189.1    CAVP010059404    CDL95787.1    JOJR01000015    RCN51257.1    JOJR01000583    RCN36166.1    JARK01001411    EYC06502.1    PDUG01000005    PIC23776.1    JARK01001345    EYC27589.1    KN726990    KIH66733.1    ODYU01006378    SOQ48174.1    JARK01000176    EYC41234.1    PDUG01000012    PIC13506.1    DS268539    EFO88027.1    DS268747    EFP00909.1    JARK01001418    EYC05389.1    JARK01000059    EYC44525.1    JARK01001499    EYB95145.1    DS268606    EFO93488.1    DS268492    EFP11689.1    DS268679    EFO98285.1    DS268508    EFO83264.1    DS268428    EFO94379.1    DS268525    EFO85497.1    JARK01000073    EYC44053.1    DS268545    EFO88382.1    DS268421    EFO88618.1    UZAH01027257    VDO90094.1    UZAH01029309    VDP05368.1    DS268673    EFO98001.1    HE601413    CAS00486.1    DS268466    EFP06959.1    PIC29926.1    DS268565    EFO90304.1    JARK01001601    EYB87313.1    PDUG01000001    PIC51673.1    JARK01001390    EYC10681.1    KX931010    APL98300.1    EFP11674.1    UZAH01036445    VDP45493.1    UZAH01001595    VDO19836.1    JARK01000255    EYC39473.1    DS268612    EFO94085.1    PIC28734.1    UYSL01020440    VDL74616.1    JARK01001421    EYC04911.1    PDUG01000004    PIC32571.1    JARK01001337    EYC34439.1    PIC24955.1    KA646003    AFP60632.1   
Pfam
PF13358   DDE_3        + More
PF00019   TGF_beta
PF16095   COR
PF00069   Pkinase
PF00078   RVT_1
PF00292   PAX
PF13936   HTH_38
Interpro
IPR009057   Homeobox-like_sf        + More
IPR038717   Tc1-like_DDE_dom       
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR032171   COR       
IPR020859   ROC_dom       
IPR000719   Prot_kinase_dom       
IPR011047   Quinoprotein_ADH-like_supfam       
IPR011009   Kinase-like_dom_sf       
IPR008271   Ser/Thr_kinase_AS       
IPR027417   P-loop_NTPase       
IPR000477   RT_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR001523   Paired_dom       
IPR025246   IS30-like_HTH       
SUPFAM
SSF46689   SSF46689        + More
SSF57501   SSF57501       
SSF56112   SSF56112       
SSF52540   SSF52540       
SSF50998   SSF50998       
Gene 3D
PDB
5CR4     E-value=7.65949e-08,     Score=132

Ontologies

Topology

Subcellular location
Secreted  
Length:
202
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.12676
Exp number, first 60 AAs:
0
Total prob of N-in:
0.07904
outside
1  -  202
 
 

Population Genetic Test Statistics

Pi
7.535108
Theta
11.554557
Tajima's D
-0.595975
CLR
22.64485
CSRT
0.216589170541473
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号