SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03628
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.757 Nuclear   Reliability : 2.141
 

Sequence

CDS
ATGAAGAAGGCTGACAGAGACCGAATAGACGCTTTTGAAATGTGGTGCTGGAGAAAAATGCTACAGATTCCATGGACCGCCTTTCGCACCAACGTGTCTATTCTGAGAGAGCTTCATGTCAAAACCAGACTTTCCACTATATGCCTTCGTAGGGTGCTGGAATTCTTCGGACATATTACTCGTAAAGAGGGTCACAATCTTGAACAGCTGATGGTGACAGGAAAGGTAGATGGCAAACGTCCCAGAGGACGCAGTCCCACGAGATGGTCGGACCAAATACGATCTTCTCTGGACATCAACTTCCACAATGCCCTTCATGAAGCTAAGGATCGCAGCAAATGGAGGGAAATCGTACAGGAGAAACTGATGCAGCGGGGGAGTCACGACCCTCAGTAA
Protein
MKKADRDRIDAFEMWCWRKMLQIPWTAFRTNVSILRELHVKTRLSTICLRRVLEFFGHITRKEGHNLEQLMVTGKVDGKRPRGRSPTRWSDQIRSSLDINFHNALHEAKDRSKWREIVQEKLMQRGSHDPQ

Summary

EMBL
FJ265548    ADI61816.1    ODYU01004401    SOQ44236.1    ODYU01001007    SOQ36619.1    + More
ODYU01003523    SOQ42419.1    KZ150366    PZC71172.1    FJ265557    ADI61825.1    FJ265559    ADI61827.1    FJ265546    ADI61814.1    FJ265547    ADI61815.1    GU815090    ADF18553.1    FJ265553    ADI61821.1    FJ265560    ADI61828.1    FJ265552    ADI61820.1    ODYU01006805    SOQ48998.1    KQ459603    KPI92872.1    KZ150203    PZC72267.1    MRZV01000056    PIK60437.1    MRZV01000940    PIK42365.1    MRZV01000378    PIK51329.1    MRZV01002322    PIK33998.1    MRZV01001216    PIK39650.1    MRZV01000817    PIK43880.1    MRZV01000196    PIK55924.1    MRZV01001207    PIK39730.1    MRZV01000994    PIK41715.1    KQ977522    KYN02133.1    AHAT01022938    AAGJ04055194    BART01031562    GAH15691.1    AJ132772    CAA10770.1    ODYU01000306    SOQ34818.1    AAGJ04161766    KL363256    KL367985    KFD50217.1    KFD59415.1    NWSH01002736    PCG67606.1    KL363266    KL367526    KFD49675.1    KFD66333.1    AHAT01012943    AHAT01009145    AHAT01015286    IACK01103929    LAA85243.1    GBHO01041897    JAG01707.1    KQ422743    KOF74343.1    LK055282    CDR71995.1    BDSA01000081    GBE63537.1    GDHC01017214    JAQ01415.1    KZ149985    PZC75696.1    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    AFYH01119920    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975    ABLF02042206    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    GU815089    ADF18552.1    GGMR01013640    MBY26259.1    AHAT01022314    KK852482    KDR22935.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049256    CEK96121.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    AHAT01025955    AHAT01013157    AHAT01013158    KK852941    KDR13536.1    KFD49622.1    KFD66271.1    GGMS01004979    MBY74182.1    HACG01049496    CEK96361.1    GGMR01005851    MBY18470.1    KK852811    KDR15914.1    KK853249    KDR09341.1    KF881086    AIJ27485.1    KK853131    KDR10935.1    KK852843    KDR15156.1    HACG01049254    CEK96119.1    HACG01049255    CEK96120.1    HACG01049245    CEK96110.1    HACG01049249    CEK96114.1    AHAT01017643   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF05699   Dimer_Tnp_hAT
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
IPR008906   HATC_C_dom       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

Length:
131
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00895999999999999
Exp number, first 60 AAs:
0.00895999999999999
Total prob of N-in:
0.68137
inside
1  -  131
 
 

Population Genetic Test Statistics

Pi
10.620758
Theta
13.274826
Tajima's D
-0.772449
CLR
0.256361
CSRT
0.179391030448478
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号