SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03595
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.906 Nuclear   Reliability : 2.424
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAATTTTGAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGTCGCGAATTCAAAGAAATCCCAAACGTAAGCAGAAACTGTTGGCCCTTCAGATGGGGTTAAGCAGAACCACGGTGAAAAGGGTGTTAAATGAAGACTTAGGGCTTCGGGCATATCGAAGAAAAACAGGACATCGTTTGAATGCTCGTCTAATGGACCTGAGACTGAAGAGATGCCGCGCTTTGTTGAAGCGGTACGCGGGAAAAAAATATCGGGAAATTCTTTTTTCGGATGAAAAAATTTTTACCGTAGAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAATTATGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGTGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTTATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKILNITKRFVYRTIKRYNEDSSVDDRSRSGRPRSVRTPAVIKAVKSRIQRNPKRKQKLLALQMGLSRTTVKRVLNEDLGLRAYRRKTGHRLNARLMDLRLKRCRALLKRYAGKKYREILFSDEKIFTVEESYNKQNDKVYAHSSEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAIMYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSTQDWLAACEIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGYFE

Summary

EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    AB473770    BAH20555.1    U47917    AAB47739.1    JF779677    AEO90418.1    LNIX01000030    OXA41211.1    JARK01001345    EYC27589.1    JARK01000176    EYC41234.1    CAVP010059404    CDL95787.1    JARK01000059    EYC44525.1    UYSL01019905    VDL71189.1    DS268747    EFP00909.1    JARK01001411    EYC06502.1    PDUG01000006    PIC20538.1    JARK01000255    EYC39473.1    PDUG01000005    PIC23776.1    DS268612    EFO94085.1    DS268508    EFO83264.1    JARK01001658    EYB84158.1    KX931010    APL98300.1    DS268492    EFP11689.1    DS268421    EFO88618.1    PDUG01000012    PIC13506.1    DS268673    EFO98001.1    DS268466    EFP06959.1    DS268525    EFO85497.1    UZAH01029309    VDP05368.1    DS268545    EFO88382.1    UZAH01027257    VDO90094.1    PIC28734.1    PDUG01000001    PIC51673.1    JOJR01000583    RCN36166.1    JOJR01000015    RCN51257.1    KN728607    KIH63514.1    JARK01001337    EYC34439.1    PDUG01000004    PIC32571.1    DS268428    EFO94379.1    PIC29926.1    DS268679    EFO98285.1    UYSL01020440    VDL74616.1    JARK01001601    EYB87313.1    DS268606    EFO93488.1    UYSL01019770    VDL69590.1    PIC32570.1    PIC53815.1    LFYR01002220    KMZ56176.1    DS268565    EFO90304.1    DS268539    EFO88027.1    HE601047    HE600964    CAS00660.1    CAS01013.1    HE601437    CAR99651.1    HE601507    CAR99239.1    HE601187    CAR99265.1    HE600908    CAR99632.1    PIC24955.1    PDUG01000003    PIC22722.1    PIC39649.1    HE600938    CAR99786.1    HAAD01005865    CDG72097.1   
Pfam
PF13358   DDE_3        + More
PF00292   PAX
PF10320   7TM_GPCR_Srsx
PF00250   Forkhead
PF13936   HTH_38
PF18397   IKBKB_SDD
PF00069   Pkinase
Interpro
IPR009057   Homeobox-like_sf        + More
IPR036388   WH-like_DNA-bd_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
IPR036906   ATPase_V1_fsu_sf       
IPR036390   WH_DNA-bd_sf       
IPR001766   Fork_head_dom       
IPR030456   TF_fork_head_CS_2       
IPR025246   IS30-like_HTH       
IPR000792   Tscrpt_reg_LuxR_C       
IPR011009   Kinase-like_dom_sf       
IPR041185   IKBKB_SDD       
IPR029071   Ubiquitin-like_domsf       
IPR000719   Prot_kinase_dom       
SUPFAM
SSF46689   SSF46689        + More
SSF46785   SSF46785       
SSF56112   SSF56112       
SSF54236   SSF54236       
Gene 3D
PDB
5HOO     E-value=6.51289e-11,     Score=161

Ontologies

Topology

Subcellular location
Nucleus  
Length:
346
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
4.01735
Exp number, first 60 AAs:
3.74318
Total prob of N-in:
0.14715
outside
1  -  346
 
 

Population Genetic Test Statistics

Pi
140.613096
Theta
57.931484
Tajima's D
4.23908
CLR
0.068782
CSRT
0.9994000299985
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号