SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03537  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA006235
Annotation
PREDICTED:_balbiani_ring_protein_3-like_isoform_X3_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 3.218
 

Sequence

CDS
ATGTGCGTTCCGCGTGATTACTGCCCAGATTCGAACATCTGCTCGCCAACGTGCGCTCAACCTAATCCACCGGACTGTCCTAATATTGATCGTAATGTATGCGAACCTGGTTATATATTGTCTGAGATCGGAGGCGTCTGCATAAAGATCGAAGATTGTCCTGCTGATGCATCCTGCAATTCTGACCCGAATGCTATAATCGCTCAGTGCCCACAACCGTGTCCTTCGACGTGTGAAGCCCCTAATGCTGTTCCGTGCAAGAAAATGTGCGAACCCGTCGGATGTGAATGCAAGCCCGGCTTCATCCGGTCAAAGGTCAACGGCAAATGCATTTTACTTGATCAGTGTCCTGGAGGCAATCCCTGTGGAGACAACGCGACTTTCATGAATTGTCGGGTGCCTTGCATAACAGACTATTGTCCCGTTAACGACACCAGAGGCGAGGTCATTTGCGATATACCCAACCCTTGCCTTTCTGGATGTGTTTGTAACTCCTACTATAAGCACCGAAGCGTCAATGACAATCAATGTATCCCCGCCAAAGAGTGTCCACCGGTCAAGTGCACCAGACCGAATGAAGTCTGGGACTCTTGTCCATCGACGTGCCTATACGAAAATTGCAACGATGTGGACAATCCGAATGTAGTGTGCGACGACAGTTGCAAAGCCGAACCCCGTTGCGTGTGCGACGAGAATCATTTTAGAAACAACGACGGAGTGTGTGTGCCAGCTGAAGAATGTCCTTCCTACGTCATCAATACTGAACGCTGA
Protein
MCVPRDYCPDSNICSPTCAQPNPPDCPNIDRNVCEPGYILSEIGGVCIKIEDCPADASCNSDPNAIIAQCPQPCPSTCEAPNAVPCKKMCEPVGCECKPGFIRSKVNGKCILLDQCPGGNPCGDNATFMNCRVPCITDYCPVNDTRGEVICDIPNPCLSGCVCNSYYKHRSVNDNQCIPAKECPPVKCTRPNEVWDSCPSTCLYENCNDVDNPNVVCDDSCKAEPRCVCDENHFRNNDGVCVPAEECPSYVINTER

Summary

Similarity
Belongs to the serpin family.
EMBL
BABH01034079    BABH01034080    JTDY01000004    KOB79511.1    KZ150221    PZC72102.1    + More
KQ459249    KPJ02419.1    KQ461181    KPJ07649.1    NWSH01004181    PCG65391.1    ODYU01002951    SOQ41102.1    KZ150198    PZC72302.1    AJVK01020418    KK120157    KFM77647.1    AJWK01008601    KN729227    KIH62569.1    ODYU01003852    SOQ43127.1    JYDQ01000343    KRY08317.1    CVRI01000004    CRK87701.1    UYRR01035050    VDK63296.1    AJWK01004621    AJWK01004622    KK114672    KFM63067.1    ODYU01010657    SOQ55910.1    GACK01010874    JAA54160.1    GACK01010873    JAA54161.1    JYDL01000037    KRX21785.1    LN609529    CEF69530.1    KY441615    ARQ31643.1    AJWK01004620    DS232623    EDS44206.1    JARK01001350    EYC24264.1    EYC24263.1    KE125129    EPB71200.1    EYC24261.1    JOJR01000037    RCN49202.1    MG770320    AXY94922.1    LC384839    BBE28982.1    AGBW02015025    OWR40695.1    AJWK01009195    AJWK01009196    NWSH01002542    PCG68017.1    JPKZ01002630    KHN75744.1    KRY08320.1    KRY08321.1    JYDK01000035    KRX81073.1    CVRI01000009    CRK88682.1    JYDH01000076    KRY33812.1    JYDJ01000057    KRX46474.1    MG770321    AXY94923.1    KRX81072.1    JARK01001342    EYC29574.1    JYDW01000009    KRZ62443.1    JYDM01000104    KRZ87210.1    JYDN01000032    KRX63333.1    KRX46475.1    GFPF01005369    MAA16515.1    KRX46473.1    GEDV01006374    JAP82183.1    EYC29575.1    KRX21786.1    KRX21783.1    IAAA01002395    IAAA01002396    LAA01006.1    MWRG01001996    PRD33208.1    IAAA01002394    LAA00998.1    KRY33814.1    AY829811    AAV91425.1    LC384844    BBE28987.1   
Pfam
PF01826   TIL        + More
PF00079   Serpin
PF00149   Metallophos
PF08321   PPP5
PF00795   CN_hydrolase
Interpro
IPR036084   Ser_inhib-like_sf        + More
IPR002919   TIL_dom       
IPR000742   EGF-like_dom       
IPR006212   Furin_repeat       
IPR036186   Serpin_sf       
IPR042178   Serpin_sf_1       
IPR042185   Serpin_sf_2       
IPR023796   Serpin_dom       
IPR011236   Ser/Thr_PPase_5       
IPR013026   TPR-contain_dom       
IPR006186   Ser/Thr-sp_prot-phosphatase       
IPR019734   TPR_repeat       
IPR004843   Calcineurin-like_PHP_ApaH       
IPR041753   PP5_C       
IPR029052   Metallo-depent_PP-like       
IPR013235   PPP_dom       
IPR011990   TPR-like_helical_dom_sf       
IPR000215   Serpin_fam       
IPR023795   Serpin_CS       
IPR003010   C-N_Hydrolase       
IPR036526   C-N_Hydrolase_sf       
IPR000132   Nitrilase/CN_hydratase_CS       
SUPFAM
SSF57567   SSF57567        + More
SSF56574   SSF56574       
SSF48452   SSF48452       
SSF56317   SSF56317       

Ontologies

Topology

Length:
256
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.07442
outside
1  -  256
 
 

Population Genetic Test Statistics

Pi
393.857967
Theta
214.504356
Tajima's D
2.446504
CLR
0.402979
CSRT
0.940202989850507
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25860555 YVDIIVNSETIADEYKPR 100.00 5e-19
24093152 IEDCPADASCNSDPNAIIAQCPQPCPSTCEAPNAVPCK 100.00 5e-19
27102218 NVCEPGYIISEIGGVCIK 100.00 5e-19
25860555 FGIYDVDFSDEGR 100.00 3e-18
24093152 IECPTGYR 100.00 3e-18
27102218 GEVICDIPNPCISGCVCNSYYK 100.00 3e-18
25860555 AADMIKEDHEIIII 97.22 4e-18
27102218 KMCEPVGCECKPGFIR 97.22 4e-18
25860555 QQYIDVGDR 100.00 4e-11
27102218 YQTVPGDSCETYSGCVCDEDRVR 100.00 4e-11
25860555 SIAPEYAK 95.45 2e-08
24093152 GESSTDK 95.45 2e-08
27102218 CTRPNEVWDSCPSTCIYENCNDVDNPNVVCDDSCK 95.45 2e-08
25860555 RQANYYSDKDITAASK 97.44 1e-06
24093152 CTRPNEVWDSCPSTCIYENCNDVDNPNVVCDDSCK 97.44 1e-06
27102218 CIIIDQCPGGNPCGDNATFMNCR 97.44 1e-06
25860555 NIDPADDPKNIERPCPNFDIDCIR 100.00 6e-05
27102218 IEDCPADASCNSDPNAIIAQCPQPCPSTCEAPNAVPCKK 100.00 6e-05
25860555 IEDCPADASCNSDPNAIIAQCPQPCPSTCEAPNAVPCKK 100.00 7e-05
24093152 SVNDNQCIPAK 100.00 7e-05
27102218 SVNDNQCIPAK 100.00 7e-05
25860555 NIERPCPNFDIDCIR 100.00 2e-04
24093152 MCEPVGCECK 100.00 2e-04
27102218 CVAIDKCPK 100.00 2e-04
25860555 GAVEIFK 100.00 0.003
24093152 VPAGPIVPGIVIPPPPDFFAPIEEK 100.00 0.003
27102218 VPCITDYCPVNDTRGEVICDIPNPCISGCVCNSYYK 100.00 0.003
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号