SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03535  Validated by peptides from experiments
Annotation
PREDICTED:_zonadhesin-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 3.527
 

Sequence

CDS
ATGTGTGCTGACCACAGACTGTCTTGTCAGTGGAAACCTTTTTCAGCTCCAGTCACGTGCACACGACCGAATGAAGTTTGGAATCCGTGTGCACAATGTTTGGCGGAACGATGCGAGGATCTCAACAGTACCTCTAACCAGAATTGTCCTGCTGAACTGCGTTCCTACTGCAGGCCGCAGTGCGTTTGTGCAAACGGCTATTACAGGAACAACAATGACGTTTGTGTCCCGAAGAAAGCTTGTCCTGGTCAGTGTCCGGTGCCCGCCAGGTGTAGACCTACCTGCTCTGTGCCGAATCCACCGAACTGTCCACCTTACAAGCCGCCTACTGAGAACGAGGACGGATGTCGATGTCAACCAGGGTACATCTTGTCTGAAACAGAAGGGAAATGTGTTAAAATAGAAACCTGCCCTAGTCCGTGCAATGCAAACGAAACGCTCGTGTACTGCAAAGCTGGCTGTCCCACCGACTATTGTCCAACAAGCGACAGCCGCGCTATAGTTGCTTGCTCACCCCCCTATCCATGTAATCCGGGCTGCGTTTGTAAACCAAATTATCGAATCTTAAGTCAGGATGACAAGCGATGTGTGCTGACCACAGACTGTCGTAAGTACAACATAGAGTATAGTAAAAATAGTTTTATTGGGCATTACGGTGATATCTTCTGGTTGTCGTAG
Protein
MCADHRLSCQWKPFSAPVTCTRPNEVWNPCAQCLAERCEDLNSTSNQNCPAELRSYCRPQCVCANGYYRNNNDVCVPKKACPGQCPVPARCRPTCSVPNPPNCPPYKPPTENEDGCRCQPGYILSETEGKCVKIETCPSPCNANETLVYCKAGCPTDYCPTSDSRAIVACSPPYPCNPGCVCKPNYRILSQDDKRCVLTTDCRKYNIEYSKNSFIGHYGDIFWLS

Summary

Similarity
Belongs to the serpin family.
EMBL
NWSH01004181    PCG65391.1    ODYU01002951    SOQ41102.1    JTDY01000004    KOB79511.1    + More
KZ150198    PZC72302.1    JYDQ01000343    KRY08319.1    NWSH01003013    PCG67110.1    KRY08323.1    NWSH01005913    PCG63849.1    PCG63850.1    KRY08320.1    JYDI01000077    KRY53944.1    KRY08317.1    JYDL01000037    KRX21786.1    KRY08321.1    AJWK01008601    JYDN01000032    KRX63333.1    JYDJ01000057    KRX46475.1    JYDW01000009    KRZ62443.1    KRX21783.1    JYDM01000104    KRZ87210.1    KRX21785.1    KRX46473.1    JYDH01000076    KRY33812.1    KRY33814.1    MWRG01001996    PRD33209.1    AJVK01020418    CVRI01000059    CRL03442.1    NWSH01002542    PCG68017.1    PCG67111.1    JYDK01000035    KRX81073.1    KRX81072.1    JYDR01000016    KRY75722.1    KRY75723.1    KZ149981    PZC75815.1    JYDS01000045    KRZ29499.1    KRY75718.1    BABH01039220    BABH01039221    BABH01039222    BABH01039223    JYDT01000094    KRY85257.1    ODYU01001563    SOQ37951.1    KRZ29498.1    MG770321    AXY94923.1    JYDO01000022    KRZ77159.1    BX284605    CAD56616.1    CAB54473.2    JTDY01002637    KOB71038.1    CVRI01000004    CRK87701.1    JYDP01000166    KRZ04345.1    BABH01029067    KK120157    KFM77647.1    CVRI01000010    CRK88925.1    LC384844    BBE28987.1    CCE71937.1    JTDY01003492    KOB69475.1    GFPF01005340    MAA16486.1   
Pfam
PF01826   TIL        + More
PF08321   PPP5
PF00149   Metallophos
PF00079   Serpin
PF01521   Fe-S_biosyn
PF03153   TFIIA
Interpro
IPR036084   Ser_inhib-like_sf        + More
IPR002919   TIL_dom       
IPR006212   Furin_repeat       
IPR000742   EGF-like_dom       
IPR004094   Antistasin-like       
IPR004843   Calcineurin-like_PHP_ApaH       
IPR011990   TPR-like_helical_dom_sf       
IPR019734   TPR_repeat       
IPR006186   Ser/Thr-sp_prot-phosphatase       
IPR013026   TPR-contain_dom       
IPR011236   Ser/Thr_PPase_5       
IPR013235   PPP_dom       
IPR029052   Metallo-depent_PP-like       
IPR041753   PP5_C       
IPR042185   Serpin_sf_2       
IPR042178   Serpin_sf_1       
IPR023796   Serpin_dom       
IPR036186   Serpin_sf       
IPR000361   FeS_biogenesis       
IPR004855   TFIIA_asu/bsu       
IPR035903   HesB-like_dom_sf       
IPR016092   FeS_cluster_insertion       
IPR000215   Serpin_fam       
IPR023795   Serpin_CS       
IPR017896   4Fe4S_Fe-S-bd       
SUPFAM
SSF57567   SSF57567        + More
SSF48452   SSF48452       
SSF56574   SSF56574       
SSF89360   SSF89360       

Ontologies

Topology

Length:
225
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00132
Exp number, first 60 AAs:
0
Total prob of N-in:
0.14204
outside
1  -  225
 
 

Population Genetic Test Statistics

Pi
160.936111
Theta
189.72746
Tajima's D
-0.612172
CLR
25.732813
CSRT
0.211139443027849
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26822097 AGCPADYCPTSDSR 95.24 4e-08
29197581 CPNDYCPVNDNR 95.24 4e-08
26822097 AVVDCAIPYPCNPGCVCK 95.24 4e-08
26822097 SPEAIGCK 95.24 2e-07
26822097 CVIATDCPPVTCTR 100.00 3e-04
26822097 PTCSVPNPPNCPPYK 100.00 0.002
25860555 NVGIAIGR 100.00 0.002
27102218 YKIPANNEDGCQCKK 100.00 0.002
29197581 ECPIACPSTCEAPEAKPCK 100.00 0.002
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号