SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03521  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA006246
Annotation
PREDICTED:_NADP-dependent_malic_enzyme_[Bombyx_mori]
Full name
Malic enzyme      
Location in the cell
Mitochondrial   Reliability : 1.339
 

Sequence

CDS
ATGTTTTCCAGTGTGTCCAGATCGTTATTATGTTGCACAAACGCAATAGGTCCAAACAGGGCCCTGGCGTACATCCTAACAAAGAACTCGATCCTCGAACCTTCCTCGATACAATGTCGGGATTACCACGAAGTAACCGGCAATATCATTTGCCCGAATGTTGTCCGAGGCATCGACCACCTTAGAGATCCTCGCCTTAATAAAGGTCTCGCGTTTACTTTAGAAGAACGTCAGGCTCTCGGCATTCACGGTCTTTTGGCGGCCAAATTCAAAAGTCAAGAAGAACAGCTGGACATTTGCAGGATATCAGTGGACAGATACGAGGACAATCTGAACAAATATCTCTACCTCGTCGAGTTACAGGATCGAAACGAGAAACTGTTCTTTAGACTTCTAGCCGAGAACGTCGAGAAGTATTTACCGATAGTGTACACTCCGACCGTTGGTCTGGCCTGTCAGAGGTTCGGCCTCATATACCGAAGGCCGAGAGGTCTCTTCGTGACTATCAACGACAAAGGCCACGTGTTTAACATCATAAAAAATTGGCCAGAACCTGATGTCCGAGCGATCGTTTTCACCGATGGCGAGAGAATATTGGGCTTGGGTGATCTCGGAGCGTACGGTATGGGGATTCCAGTGGGAAAGCTGTCGCTTTACACAGCTCTGGCTGGGATTAAGCCACACCAATGCTTACCGATTACGCTGGACGTCGGAACGGACAATCAGGTAAAACTTGAAACCATGGCCTAA
Protein
MFSSVSRSLLCCTNAIGPNRALAYILTKNSILEPSSIQCRDYHEVTGNIICPNVVRGIDHLRDPRLNKGLAFTLEERQALGIHGLLAAKFKSQEEQLDICRISVDRYEDNLNKYLYLVELQDRNEKLFFRLLAENVEKYLPIVYTPTVGLACQRFGLIYRRPRGLFVTINDKGHVFNIIKNWPEPDVRAIVFTDGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTDNQVKLETMA

Summary

Similarity
Belongs to the malic enzymes family.
Belongs to the peptidase C19 family.
EMBL
BABH01034014    BABH01034015    BABH01034016    BABH01034017    KZ149899    PZC78630.1    + More
KQ459249    KPJ02430.1    NWSH01001337    PCG71618.1    ODYU01001426    SOQ37596.1    KQ461181    KPJ07636.1    AGBW02009653    OWR50228.1    NEVH01020327    PNF21947.1    AAAB01008880    EGK97005.1    APCN01002552    GEBQ01017403    JAT22574.1    AXCM01000270    GAMD01002043    JAA99547.1    KK853743    KDQ87031.1    KA646941    AFP61570.1    KA646942    AFP61571.1    AXCN02001157    GGFK01004902    MBW38223.1    GGFK01004916    MBW38237.1    ADMH02000944    ETN64604.1    GFDF01001848    JAV12236.1    GDAI01000138    JAI17465.1    GFXV01000666    MBW12471.1    GECZ01000197    JAS69572.1    CH477207    EAT47850.1    GGFJ01003263    MBW52404.1    GGFJ01003314    MBW52455.1    JXUM01100888    JXUM01100889    KQ564606    KXJ72035.1    JXUM01021496    JXUM01021497    JXUM01021498    KQ560602    KXJ81680.1    GGFM01002542    MBW23293.1    GGFM01002520    MBW23271.1    GANO01001567    JAB58304.1    KQ971310    EEZ99125.1    DS232039    EDS32800.1    UFQS01001564    UFQT01001564    SSX11469.1    SSX31036.1    GEDC01012664    JAS24634.1    GEDC01028213    JAS09085.1    GAPW01000494    JAC13104.1    GFDL01007813    JAV27232.1    AJVK01029972    PYGN01001288    PSN35985.1    GALX01003447    JAB65019.1    GECU01000718    JAT06989.1    GBHO01023663    GBRD01005565    GDHC01002619    JAG19941.1    JAG60256.1    JAQ16010.1    ABLF02026860    ABLF02026861    GFXV01007658    MBW19463.1    GGMR01001713    MBY14332.1    JRES01001160    KNC25050.1    CM000160    EDW98538.1    ACPB03014452    CH480828    EDW45208.1    KRK04335.1    GGMS01005184    MBY74387.1    GBBI01002297    JAC16415.1    GECL01000725    JAP05399.1    BABH01034018    PNF21946.1    CH933806    EDW14656.1    OUUW01000005    SPP80578.1    KRG01135.1    CH964232    EDW81113.1    GDRN01107055    JAI57478.1    CP012526    ALC46036.1    CVRI01000041    CRK95392.1    SPP80579.1    KRF99390.1    SPP80577.1    CH479179    EDW24011.1    CH916374    EDV91599.1    CH940650    EDW67844.1    GDRN01107058    JAI57477.1    KRF83517.1    AJ251546    CAB64263.1    JXJN01007685    CH954182    EDV53454.1    AE014297    AY051465    AAF56674.1    AAK92889.1    GDRN01107060    JAI57476.1    ACZ95044.1    ACZ95043.1    GAMC01019021    JAB87534.1    CCAG010001986    CM000070    EAL27424.3   
Pfam
PF03949   Malic_M        + More
PF00390   malic
PF00431   CUB
PF00443   UCH
PF01074   Glyco_hydro_38N
PF07748   Glyco_hydro_38C
PF09261   Alpha-mann_mid
Interpro
IPR037062   Malic_N_dom_sf        + More
IPR001891   Malic_OxRdtase       
IPR012302   Malic_NAD-bd       
IPR015884   Malic_enzyme_CS       
IPR012301   Malic_N_dom       
IPR036291   NAD(P)-bd_dom_sf       
IPR035914   Sperma_CUB_dom_sf       
IPR000859   CUB_dom       
IPR016024   ARM-type_fold       
IPR015341   Glyco_hydro_38_cen       
IPR011013   Gal_mutarotase_sf_dom       
IPR000602   Glyco_hydro_38_N       
IPR011330   Glyco_hydro/deAcase_b/a-brl       
IPR028889   USP_dom       
IPR037094   Glyco_hydro_38_cen_sf       
IPR027291   Glyco_hydro_38_N_sf       
IPR028995   Glyco_hydro_57/38_cen_sf       
IPR038765   Papain-like_cys_pep_sf       
IPR018200   USP_CS       
IPR011989   ARM-like       
IPR013780   Glyco_hydro_b       
IPR011682   Glyco_hydro_38_C       
IPR001394   Peptidase_C19_UCH       
SUPFAM
SSF51735   SSF51735        + More
SSF49854   SSF49854       
SSF48371   SSF48371       
SSF74650   SSF74650       
SSF54001   SSF54001       
SSF88713   SSF88713       
SSF88688   SSF88688       
PDB
1GQ2     E-value=1.09102e-71,     Score=684

Ontologies

Topology

Length:
249
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.3319
Exp number, first 60 AAs:
0.00534
Total prob of N-in:
0.01463
outside
1  -  249
 
 

Population Genetic Test Statistics

Pi
169.951239
Theta
17.659563
Tajima's D
-0.639652
CLR
1.657539
CSRT
0.212739363031848
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号