SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03507
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 1.299 Nuclear   Reliability : 1.162
 

Sequence

CDS
ATGACCATTAACGCTGGCGTTCCACAAGGTTCGGTGCTCTCCTCCACGCTTTTCATCCTGTATATCAATGACATGCTGTCTATTGATGGCATGCATTGTTATGCGGATGACAGCATGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGGAGCGTGGTGCAAGAGAAACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCGAATGGGATGAATTGAGCTTGGTTCAATTCAACCCGATAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTAGAAACTTCCGGGAGTATCGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAATTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCAAAGCGGTACTTCACGCCTGGACAAAGACTTTTGCTCTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTTTAG
Protein
MTINAGVPQGSVLSSTLFILYINDMLSIDGMHCYADDSMGDARYIGHQSLSRSVVQEKRSKLVSEVENSLGRVSEWDELSLVQFNPIKTQVCAFTAKKDPFVMAPQFQGVSLETSGSIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHL

Summary

EMBL
AY359886    AAQ57129.1    FM995623    CAX36787.1    ODYU01002162    SOQ39302.1    + More
GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    GFAC01000919    JAT98269.1    GEFM01002394    JAP73402.1    GEGO01001118    JAR94286.1    GEFM01005904    JAP69892.1    NSIT01000637    PJE77413.1    AAGJ04119271    FLMD02000280    SCV66640.1    GFAA01002514    JAU00921.1    GEGO01002473    JAR92931.1    ODYU01001756    SOQ38395.1    GBIH01002577    JAC92133.1    GEGO01004132    JAR91272.1    GEGO01004056    JAR91348.1    HAAD01000593    CDG66825.1    GFAC01005646    JAT93542.1    GDRN01111334    JAI56796.1    NSIT01000538    PJE77518.1    GEGO01007341    JAR88063.1    LSMT01000248    PFX22193.1    GEFM01002324    JAP73472.1    NSIT01000477    PJE77602.1    LSMT01000115    PFX26931.1    GEGO01003312    JAR92092.1    LSMT01000057    PFX30021.1    GEGO01004433    JAR90971.1    GANO01002501    JAB57370.1    LSMT01000222    PFX22988.1    GGMR01016717    MBY29336.1    GEFM01006407    JAP69389.1    GACK01003803    JAA61231.1    LSMT01000646    PFX15469.1    GEGO01007438    JAR87966.1    GFAC01005665    JAT93523.1    GDRN01111326    JAI56798.1    GEFM01006417    JAP69379.1    GEGO01004630    JAR90774.1    GEGO01007187    JAR88217.1    GFAC01000861    JAT98327.1    NSIT01000532    PJE77527.1    GADI01001229    JAA72579.1    GEFM01002398    JAP73398.1    GEFM01006250    JAP69546.1    AAGJ04124300    GEFM01005882    JAP69914.1    MRZV01001974    PIK35151.1    GEGO01003896    JAR91508.1    GANO01004026    JAB55845.1    NSIT01000294    PJE78013.1    MRZV01000037    PIK61266.1    NSIT01000539    PJE77517.1    GANO01004296    JAB55575.1    MRZV01000639    PIK46517.1    LSMT01000297    PFX20951.1    GANP01010944    JAB73524.1    GEGO01004857    JAR90547.1    NSIT01000462    PJE77627.1    PFX29995.1    GEGO01005479    JAR89925.1    GALX01002327    JAB66139.1    NSIT01000271    PJE78081.1    NSIT01000412    PJE77717.1    GFAA01002470    JAU00965.1    GEGO01003794    JAR91610.1    AAGJ04090645    GEFM01005840    JAP69956.1    GCES01143686    JAQ42636.1    GEGO01007027    JAR88377.1    GFWV01000938    MAA25668.1    GEGO01004248    JAR91156.1    GCES01099194    JAQ87128.1    GCES01126385    JAQ59937.1    JXUM01071389    KQ562662    KXJ75371.1    GEFM01005905    JAP69891.1    GDRN01111278    JAI56803.1    GEFH01000988    JAP67593.1    GEEE01008982    JAP54243.1    GEEE01011145    JAP52080.1    GEGO01003567    JAR91837.1    BN000795    CAJ00238.1    GALA01001771    JAA93081.1    GEGO01003111    JAR92293.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF02460   Patched
PF03385   STELLO
PF16045   LisH_2
PF00096   zf-C2H2
PF02182   SAD_SRA
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR030223   Dispatched       
IPR003392   Ptc/Disp       
IPR000731   SSD       
IPR019786   Zinc_finger_PHD-type_CS       
IPR011011   Znf_FYVE_PHD       
IPR019787   Znf_PHD-finger       
IPR013083   Znf_RING/FYVE/PHD       
IPR005049   STL-like       
IPR006594   LisH       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR015947   PUA-like_sf       
IPR036987   SRA-YDG_sf       
IPR003105   SRA_YDG       
SUPFAM
SSF56219   SSF56219        + More
SSF57903   SSF57903       
SSF57667   SSF57667       
SSF88697   SSF88697       
Gene 3D

Ontologies

Topology

Subcellular location
Nucleus  
Length:
179
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
2.17593
Exp number, first 60 AAs:
2.16403
Total prob of N-in:
0.12235
outside
1  -  179
 
 

Population Genetic Test Statistics

Pi
56.139564
Theta
51.653084
Tajima's D
0.27036
CLR
0.110273
CSRT
0.444977751112444
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号