SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03422  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA014287
Annotation
PREDICTED:_4-coumarate--CoA_ligase_1-like_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 2.857
 

Sequence

CDS
ATGTTGGAGCATATCCGACAGTGGAATGACCAAATTGCAATAGAAAATGCTGATACAGGTGAAAAACTATCGTACAAAGAAATCGCACAGTATGTTGTGAACCTTTCCGCGTCTTTGACGAGCCTTGGGGTCGGAAGAGGTGATACAGTGGCACTCGGGTCGGAAAAACACAATGAATTTGTTCCGACTTTGCTTGCAATTGTATTGACTGGAGCCACCTATACACCTTACGATTTGAAAGTTGGAAAAGCCTCGTTAAAACACAAACTAAGTGTAGTGAAACCTAAATATTTTATTTATTCAAATAAGTTTTGGTTGACGTACAGCGACGTCTTAAAGAGTTTTGACTGCATACAAACGTACTTCACTCTGGAAGACAACAGCGAGGGTGTGGTTTCCATAAAAAGCTTAGCATCCAAATATGTCGATGTGGATCTGTTTGAACCGACGCCGGTTCAAGGACAAATAGATACAGCAGCTGTATTATATTCATCAGGAACTACTGGTATGCCGAAAGGAGTTCAATTAACTCACTTGAATTGTATACTAAGCAGTCTACCTTCTAATTTCAGCTACGAATCTCTGCAGACTGTTTTCATTTTTGGTGTATGGTATCATAATTACGATACATTTATGACGTATAAATTTTTAACGAAGGGGAAGAAAATTGTTTACGTGGATAATCCGACCCCAATTGCGATTCTTAAAACCATTGAACTTATGAAGGTTAACATTGGATTTGTCGTGCCATCTTTTTTCCATTATATTTCGAAAAATGATGAAGTAAAAAATTACAATTTAGATTCTCTGAAAATAATTTATTCACGCGCAAGCCCTCTTCATATTAAGACCATGGAAAAAGTGAAAGAAAGATTACCGAAATTAAATTACATAATTCAAGGATATGGGATGACAGAAGCTGGAGAATTAAGTTCAGAGTGCTGGGGCGATAAAGGAACTAAACTCGGGAGTGTTGGCAAGACTACACCTGGCCTTATACTAAAGGTTGTAGATCCCGAAACCCGTCAAGTACTGGGCGCAAATCGTCGTGGCGAAATTTGCCTTAAAGGACCTGTTTTTATGAAGGGTTACATAGGAGTAGACCCTTCAATTTACCTAGACGAGGAAGGTTTCTTCAGAACGGGGGACTTAGGTTATTACGACGAAGACAAATACTTTTACATTGTCGATAGATTAAAGGAAATTATTTCATATCAAGGACACCAGGTTCCACCCACGGAACTAGAGACTGTCCTGTTACTCCATCCTGCAGTGAAAGAGGCGGGTGTGGTCGGAAAACCTCATCCAGAGGACGATGAACTGCCAACAGCTTTTATAGTAAAGCGCCCAGGATTTAATGTTACCGAACAGGAGTTAATTGATTTTGTGGTTGCAGAAGTTCCACCATATATGGAATTAAAAGGTGGTATTCGATTTATAAATGAATTACCAAGAAACCCTAGAGGCAAAATATTAAGAAGAACTCTTCGCGATATGCTTTTGAAAGAACAGTGGAAAGGAGCGAAAGCTAGAGAAATTGGTGAAGGATATAAGCTGTATTATAGTGGAAGTGATGGAAGAAGGAATGGCGTGGGAGTAGTGTTAGATAAGGATTTGAAAGATTGTGTGGCGCATGTCATAAGAACGAGTGATAGGATAATAACCGTAAAAATAGTTTGTGAAAGTGTTATTTTGAATGTTATAAGTGTGTACGCGCCTCAGTCCGGGTGCAAGGAGCACGTGAAAGAGAAATTTTGGCAGGATTTTGATAGTGTTATGATTCGCATTCCAGAGAGTGAAGAGATTTGTATAGGAGGTGATTTTAATGGACATGTAGGAGCTACAAATGAGGGCTATGAAAGGGTGCATGGAGGGTGGGGGTATGGCAATCGTAATGATGATGGAGACCAGTTGCTCCAAGCTGCGACCACCTTTAACCTGGCAGTGGCGAATACGTGGTTCCAGAAACGGCCTGAACACCTTATCACCTATAAGAGTGGTAAACACGCGACACAGATCGACTACTTTCTGATTAAGAGAAGTAAGTTGGTATGTGTCAAAAACTGCAAAGTACTGCCGGGTGAAGCATTGGTGACGCAGCATAGACTGTTACTAATGGACATTACAATCAGTTACAAGTACCTAAGGAGGAAAAACCGTCTCTCGTCAAAAATTAGATGGCGTATGCTAGAGACAGATGAGTATGCTGGTCGATTTAGGGAAATAATGATAGAAAACATCTTGGAAATGAAGGATATGAAAGAGAAATCTGCGAATGATTGTTGGGATGAAATGGCAAATAGTGTCAGGAAGACAGCTAAGGCTGTGCTCGGCGAATCAAAAGGGAAAGGTATAATTGACAAGGATACATGGTGGTGGAATGAGAATGTACAGAGAGAATTGAAAGAAAAGAAGAATGCATTCAAAAAGTGGCAACTAGAAAGAGGTAATGAAAGTGAGAGGCAAGCTAGGAAGAATGAGTATAGAGAATGTAAGAAAAAGGCCACTAAAGCAGTTGCTATAGCCAGCTAG
Protein
MLEHIRQWNDQIAIENADTGEKLSYKEIAQYVVNLSASLTSLGVGRGDTVALGSEKHNEFVPTLLAIVLTGATYTPYDLKVGKASLKHKLSVVKPKYFIYSNKFWLTYSDVLKSFDCIQTYFTLEDNSEGVVSIKSLASKYVDVDLFEPTPVQGQIDTAAVLYSSGTTGMPKGVQLTHLNCILSSLPSNFSYESLQTVFIFGVWYHNYDTFMTYKFLTKGKKIVYVDNPTPIAILKTIELMKVNIGFVVPSFFHYISKNDEVKNYNLDSLKIIYSRASPLHIKTMEKVKERLPKLNYIIQGYGMTEAGELSSECWGDKGTKLGSVGKTTPGLILKVVDPETRQVLGANRRGEICLKGPVFMKGYIGVDPSIYLDEEGFFRTGDLGYYDEDKYFYIVDRLKEIISYQGHQVPPTELETVLLLHPAVKEAGVVGKPHPEDDELPTAFIVKRPGFNVTEQELIDFVVAEVPPYMELKGGIRFINELPRNPRGKILRRTLRDMLLKEQWKGAKAREIGEGYKLYYSGSDGRRNGVGVVLDKDLKDCVAHVIRTSDRIITVKIVCESVILNVISVYAPQSGCKEHVKEKFWQDFDSVMIRIPESEEICIGGDFNGHVGATNEGYERVHGGWGYGNRNDDGDQLLQAATTFNLAVANTWFQKRPEHLITYKSGKHATQIDYFLIKRSKLVCVKNCKVLPGEALVTQHRLLLMDITISYKYLRRKNRLSSKIRWRMLETDEYAGRFREIMIENILEMKDMKEKSANDCWDEMANSVRKTAKAVLGESKGKGIIDKDTWWWNENVQRELKEKKNAFKKWQLERGNESERQARKNEYRECKKKATKAVAIAS

Summary

Uniprot
ProteinModelPortal
PDB
2D1S     E-value=2.55906e-74,     Score=712

Ontologies

Topology

Length:
843
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.33057
Exp number, first 60 AAs:
0.05097
Total prob of N-in:
0.01505
outside
1  -  843
 
 

Population Genetic Test Statistics

Pi
163.051432
Theta
213.982532
Tajima's D
-0.820543
CLR
1569.621251
CSRT
0.170241487925604
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 LIFLVFRYEHQEIASNCGTMLRECARYEALAKIMLYSDDFYNFFRYVEVSTFDIASDAFSTFKVFFLF 98.18 3e-31
31250652 VTDVVLETEFDGER 100.00 3e-12
27102218 IGSVGK 95.45 4e-09
27102218 GYIGVDPSIYIDEEGFFR 100.00 7e-05
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号