SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03420  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA014287
Annotation
PREDICTED:_luciferin_4-monooxygenase-like_isoform_X1_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 2.075 Nuclear   Reliability : 1.442
 

Sequence

CDS
ATGTTCGGCATCAGAACACCAGTTAAAAAACCAAACGGCAGTGAGGACAAGTCTGAATTCGAAGGACAGCCAGGTCCGTCTGTAAGGCGCAGCATTGGTGATTGGCCCCCCATAGTCGAAAAAGAGCAGCAAAGGCCAAAAACACCATCTCCACCAAAAGCTGTGCCTCAGCCGCTCCCTCCTAGGCCTAAGACCAAAGCGTTGATCGCCCAGGAAGCAAAAGCTGACCCACGGAAACAGGCGGCAAGAGTCAGTGACAGCCCGCCAATTACAGTCCCGTCGAGATTTCCGAGCAAAACCGCAGAGGCTAAAGCGTGCCTTATGAAAAGCAAGGCGGAGCTCGAAATCTCCAAAAACCTAAAACGGGAGATAAAAGAAGAAGTTTTTAGGTCAATCGAACGGCTCTACCAGCTGGTGAAAGAAGCCGAAGGCGAAAAGGCTTCCCAAGCCACCAACAAGTGGCCGACAGAAGCCTGTAGCATGGTCACTCGGACTGGTAACGAGGGTGACATATCACCGGGCCCAGAAGCGCCGACAGAGCTCATGAAACAGCTAATAGGCGGCCTCAAACAGCACCACGTTGCGTTAGAGGAATGCAAATGGCATACTCGAGCTCTGTCGGAACAGCTGGAGCAAACCCCTCTCTACGCCGCAGGACATGGGTCATTAGACGAACACAGCCAACTCTTAAAGGAAAACAAAGAAGAAATAGAAAAACTAAGTGAAGAAATAAAAAAGCAAAGGACAGAATGGAAAGAAAATAGGAGCTACGCAAGCGTTGTTGTAGATCCCGAAACCCGTCAAGTACTGGGCGCAAATCGTCGTGGCGAAATTTGCCTTAAAGGACCTGTTTTTATGAAGGGTTACATAGGAGTAGACCCTTCAATTTACCTAGACGAGGAAGGTTTCTTCAAAACGGGGGACTTAGGTTATTACGACGAAGACAAATACTTTTACATTGTCGATAGATTAAAGGAAATTATTTCATATCAAGGAGACCAGGTTCCACCCACGCAACTAGAGACTATCCTGTTACTCCATCCTGCAGTGAAAGAGGCGGGTGTGGTCGGAAAACCTAATCCAGAGTACGATGAACTGCCAACAGCCTTTATAGTAAAGCGCCCAGGATTTAATGTTACCGAACAGGAATTAATTGATTTTGTGGTTTCAGAAGTTCCACCATATATGGAATTGAAAGGTGGTATTCGGTTTATAAATGAATTACCAAGAAATCCTAGAGGCAAAATATTAAGAAGAACTCTTCGCGATATGCTTTTAAAAGAACAGTAA
Protein
MFGIRTPVKKPNGSEDKSEFEGQPGPSVRRSIGDWPPIVEKEQQRPKTPSPPKAVPQPLPPRPKTKALIAQEAKADPRKQAARVSDSPPITVPSRFPSKTAEAKACLMKSKAELEISKNLKREIKEEVFRSIERLYQLVKEAEGEKASQATNKWPTEACSMVTRTGNEGDISPGPEAPTELMKQLIGGLKQHHVALEECKWHTRALSEQLEQTPLYAAGHGSLDEHSQLLKENKEEIEKLSEEIKKQRTEWKENRSYASVVVDPETRQVLGANRRGEICLKGPVFMKGYIGVDPSIYLDEEGFFKTGDLGYYDEDKYFYIVDRLKEIISYQGDQVPPTQLETILLLHPAVKEAGVVGKPNPEYDELPTAFIVKRPGFNVTEQELIDFVVSEVPPYMELKGGIRFINELPRNPRGKILRRTLRDMLLKEQ

Summary

Uniprot
ProteinModelPortal
PDB
2D1T     E-value=6.92315e-46,     Score=464

Ontologies

Topology

Length:
429
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0002
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00822
outside
1  -  429
 
 

Population Genetic Test Statistics

Pi
160.639397
Theta
211.481506
Tajima's D
0.290536
CLR
0.487803
CSRT
0.454127293635318
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号