SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03419  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA014287
Annotation
PREDICTED:_acetyl-coenzyme_A_synthetase_1-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.385
 

Sequence

CDS
ATGTTGGAACATATCCGACAGTGGAATGACGAAATTGCAATAGAAAATGCTGATACAGGTGAAAAACTATCGTACAAAGAAATCGCACAGTATGTTGTGAACCTTTCCGCGTCTTTGACGAGCCTTGGAGTCGGAAGAGGAGATACAGTGGCACTCGGGTCGCAAAAACACAATGAATTTGTTCCGACTTTGCTTGCAATTGTATTGACTGGAGCCACCTATACACCATAA
Protein
MLEHIRQWNDEIAIENADTGEKLSYKEIAQYVVNLSASLTSLGVGRGDTVALGSQKHNEFVPTLLAIVLTGATYTP

Summary

Similarity
Belongs to the ATP-dependent AMP-binding enzyme family.
Belongs to the peptidase S1 family.
EMBL
BABH01044598    NWSH01003607    PCG66062.1    ODYU01000123    SOQ34366.1    JTDY01001941    + More
KOB72488.1    JTDY01000482    KOB76976.1    JTDY01002678    KOB70956.1    JTDY01001219    KOB74496.1    KOB74498.1    KQ459249    KPJ02300.1    JTDY01002474    KOB71343.1    KOB71342.1    ODYU01009054    SOQ53186.1    ODYU01000100    SOQ34295.1    ODYU01002875    SOQ40902.1    JN127350    AET05796.1    BABH01007891    KQ459593    KPI96567.1    AGBW02008380    OWR53543.1    NWSH01001030    PCG73036.1    KQ460045    KPJ18230.1    KQ459604    KPI92263.1    KQ460890    KPJ10988.1    JTDY01001065    KOB74983.1    OWR53544.1    ODYU01009511    SOQ54004.1    KPI96565.1    KPJ10987.1    PCG73033.1    KPJ10989.1    KQ461181    KPJ07625.1    AK403860    BAM19985.1    PEFT01000001    PIG70670.1    JTDY01007153    KOB65430.1    NOZM01000004    OZE68710.1    KPI96573.1    NWSH01003686    PCG65919.1    OAOJ01000001    SNX56806.1    KPJ10986.1    RKRB01000001    RPF31434.1    CP010519    AJE80497.1    PDJK01000001    PFG57310.1    ODYU01004352    SOQ44136.1    DNIW01000129    HBD11853.1    NWSH01000380    PCG76826.1    KPI96564.1    LGEC01000105    KOX11032.1    FNOK01000048    SDZ14317.1    PGYX01000001    PKM01163.1    FMYS01000006    SDD42325.1    KZ149903    PZC78438.1    PEBB01000071    PJK22428.1    ODYU01011856    SOQ57839.1    JXTE01000029    KKD06322.1    PNYA01000002    PMS23068.1    QLLV01000017    RAJ50021.1    CP027306    AXE75899.1    NPKF01000001    OYP17903.1    LN997842    CUW28146.1    LGUS01000061    LMWZ01000003    KOG39887.1    KUO01030.1    JMHS01000024    OKH73598.1    KX708431    APD72103.1    QUNO01000009    REH43723.1    FMIC01000002    SCL50715.1    ANMG01000033    EMD26452.1    FMHT01000003    SCL14711.1    AGBW02012531    OWR44889.1    LQYX01000001    KYD31244.1    CP011072    AKU12394.1    QQAT01000016    RDI20464.1    ODYU01003402    SOQ42112.1    AP014940    BAV97564.1    KPI96566.1    PJNB01000001    PKW16455.1    LMEZ01000008    KQY03935.1    NEVE01000034    OWA06208.1    CP016174    ANN20076.1    CYHF01000014    CUB00447.1    LZHW01000101    OBF11851.1    RFHH01000039    RMG48180.1    FMDK01000013    SCF61112.1    MTQP01000055    ONI89757.1    FMHW01000002    SCL27341.1    AOEX01000025    EME66209.1    RFFH01000001    RMI35083.1    ASHX02000001    OEJ93967.1    QKYN01000093    RAG83175.1    MLQM01000148    OHU98270.1    JFCB01000001    KES08707.1    KY654519    ARU08075.1    U82965    AAM80537.1    NADR01000003    OQP07350.1    QUNO01000018    REH35336.1    LKGY01000123    KTC11023.1    LWKZ01000024    OKI00759.1    JQOF01000026    KGA39752.1    RBQQ01000043    RMP67011.1    AK403861    BAM19986.1    PITL01000002    PKR46790.1   
Pfam
PF13193   AMP-binding_C        + More
PF00501   AMP-binding
PF00550   PP-binding
PF00975   Thioesterase
PF00668   Condensation
PF00296   Bac_luciferase
PF08241   Methyltransf_11
PF00089   Trypsin
PF08242   Methyltransf_12
PF04299   FMN_bind_2
PF07993   NAD_binding_4
PF02801   Ketoacyl-synt_C
PF14765   PS-DH
PF13649   Methyltransf_25
PF08659   KR
PF00109   ketoacyl-synt
PF00698   Acyl_transf_1
PF16197   KAsynt_C_assoc
Interpro
IPR020845   AMP-binding_CS        + More
IPR042099   AMP-dep_Synthh-like_sf       
IPR000873   AMP-dep_Synth/Lig       
IPR025110   AMP-bd_C       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR010071   AA_adenyl_domain       
IPR020459   AMP-binding       
IPR036736   ACP-like_sf       
IPR009081   PP-bd_ACP       
IPR020806   PKS_PP-bd       
IPR020802   PKS_thioesterase       
IPR023213   CAT-like_dom_sf       
IPR006162   Ppantetheine_attach_site       
IPR001031   Thioesterase       
IPR001242   Condensatn       
IPR029058   AB_hydrolase       
IPR029063   SAM-dependent_MTases       
IPR024011   Biosynth_lucif-like_mOase_dom       
IPR013216   Methyltransf_11       
IPR036661   Luciferase-like_sf       
IPR011251   Luciferase-like_dom       
IPR001254   Trypsin_dom       
IPR018114   TRYPSIN_HIS       
IPR009003   Peptidase_S1_PA       
IPR001314   Peptidase_S1A       
IPR033116   TRYPSIN_SER       
IPR013217   Methyltransf_12       
IPR012349   Split_barrel_FMN-bd       
IPR007396   TR_PAI2-type       
IPR010060   NRPS_synth       
IPR013120   Male_sterile_NAD-bd       
IPR010080   Thioester_reductase-like_dom       
IPR036291   NAD(P)-bd_dom_sf       
IPR006342   FkbM_mtfrase       
IPR020841   PKS_Beta-ketoAc_synthase_dom       
IPR020807   PKS_dehydratase       
IPR001227   Ac_transferase_dom_sf       
IPR013968   PKS_KR       
IPR020843   PKS_ER       
IPR014030   Ketoacyl_synth_N       
IPR016039   Thiolase-like       
IPR020801   PKS_acyl_transferase       
IPR002364   Quin_OxRdtase/zeta-crystal_CS       
IPR042104   PKS_dehydratase_sf       
IPR011032   GroES-like_sf       
IPR032821   KAsynt_C_assoc       
IPR014043   Acyl_transferase       
IPR016036   Malonyl_transacylase_ACP-bd       
IPR041698   Methyltransf_25       
IPR016035   Acyl_Trfase/lysoPLipase       
IPR014031   Ketoacyl_synth_C       
IPR002464   DNA/RNA_helicase_DEAH_CS       
IPR017529   AcylCoA_ligase_PEP_1       
SUPFAM
SSF56219   SSF56219        + More
SSF47336   SSF47336       
SSF53474   SSF53474       
SSF53335   SSF53335       
SSF51679   SSF51679       
SSF50494   SSF50494       
SSF51735   SSF51735       
SSF52151   SSF52151       
SSF53901   SSF53901       
SSF55048   SSF55048       
SSF50129   SSF50129       
PDB
6P1J     E-value=0.000217372,     Score=99

Ontologies

Topology

Length:
76
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.32096
Exp number, first 60 AAs:
0.15959
Total prob of N-in:
0.43537
outside
1  -  76
 
 

Population Genetic Test Statistics

Pi
256.426974
Theta
167.47086
Tajima's D
1.67068
CLR
0
CSRT
0.819609019549023
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号