SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03411
Pre Gene Modal
BGIBMGA004264
Annotation
Retrovirus-related_Pol_polyprotein_from_transposon_17.6_[Exaiptasia_pallida]
Location in the cell
Nuclear   Reliability : 3.106
 

Sequence

CDS
ATGACTGAAACACCCACAACAAACATGGTGTCAGGTGTGGGGTTCCTGCCACTTTTACCCAATATGGATTTCAAAGGTAACCTTGCCGAAAATTTCAAAATGTATCGTCAAAGGTTGGAGATATATTTGTCTGCTAATGGCCTTGATGACGCCAAAGACAAAAGAAAAATATCAATTCTGCTGAATTTTATTGGCGAAAACGGAATCAAAATCTACAATTCTTTCAACTTAAACGCATCTGAATCACATACTTTTGAACACGTGCTCAAAAAGTTTGAGGCGTACTTTGAACCAAAGAAAAGTCTAACTATAGCAAGGAACGAGTTTTTTACTGTTACACAAGATGAAGACAGGTTGGAGGATTACTTTCAAAGAGTAATAAATCTCGGTATTCAATGCGAACTTGGAGATCTCAGAGAAGGGTTGACAGTGGGAAAGATAATTTCAGGGTTAGACTCCAAATATAATAATCTCAAAACACGATTAATGTCGGAAGACGATAGTAAATTAACATTAGATTATGTTATGAAATACTTACTGAGTGCCGAAACCTCTAGAAAATATATAGAAGAAAAAACAAATTCCAAAGACAGCGATGAATCCTCCATCCTATATGTTAATAAAAAATCAATAAGGAACTGTAGAAACTGTGGCACATCTCATAATATAAATAAATGCCCAGCATACGGCAAGGAGTGTCTGAAGTGCAAGAAACTTAACCATTTTAGTAAAGTATGCAGATCAGCCAAGAAACCAAATTTTTATCAAAAGCAAGTCAATGTCCTTGAGGATCCAGATAAGAACAAAGAGGATGAAGCTCAAGGAGATTTCTTTGTTGGTTATGCAGGCAATGAAATAATTCAAGATTTTACAGTCAATAACATCAAAATTCCCATCAAAATGGACACTGGAGCTGCATGCAACGTGATTGGGAGCGAATGA
Protein
MTETPTTNMVSGVGFLPLLPNMDFKGNLAENFKMYRQRLEIYLSANGLDDAKDKRKISILLNFIGENGIKIYNSFNLNASESHTFEHVLKKFEAYFEPKKSLTIARNEFFTVTQDEDRLEDYFQRVINLGIQCELGDLREGLTVGKIISGLDSKYNNLKTRLMSEDDSKLTLDYVMKYLLSAETSRKYIEEKTNSKDSDESSILYVNKKSIRNCRNCGTSHNINKCPAYGKECLKCKKLNHFSKVCRSAKKPNFYQKQVNVLEDPDKNKEDEAQGDFFVGYAGNEIIQDFTVNNIKIPIKMDTGAACNVIGSE

Summary

EMBL
MRZV01000161    PIK56894.1    MRZV01000519    PIK48493.1    ABLF02013930    ABLF02013934    + More
HADY01023773    HAEJ01006887    SBS47344.1    KK118858    KFM74040.1    GGMR01000868    MBY13487.1    AGBW02008504    OWR53150.1    GGMR01005013    MBY17632.1    HAED01014930    SBR01375.1    GEZM01020000    JAV89472.1    HADZ01022257    SBP86198.1    GCES01104253    JAQ82069.1    GEZM01041944    JAV80090.1    GCES01110503    JAQ75819.1    GEZM01035137    JAV83383.1    GBGD01000119    JAC88770.1    GBGD01000115    JAC88774.1    GEZM01001974    JAV97427.1    GACK01009641    JAA55393.1    GBHO01004090    JAG39514.1    HAED01020456    SBR07020.1    NWSH01000088    PCG79705.1    GEZM01050758    JAV75411.1    ABLF02038957    MRZV01000033    PIK61397.1    GDHC01013957    JAQ04672.1    GCES01096219    JAQ90103.1    AERX01076149    KF319019    AIE48224.1    GEZM01001973    JAV97431.1    GGMR01004179    MBY16798.1    AERX01070080    MRZV01000718    PIK45343.1    ABLF02041865    ACPB03002101    ACPB03002102    ACPB03002103    GBBI01004745    JAC13967.1    ACPB03019169    MRZV01000723    PIK45255.1    ABLF02008456    KQ980844    KYN12280.1    MRZV01000576    PIK47528.1    ABLF02010707    KV461054    OCA14957.1    ABLF02019772    GEZM01050997    GEZM01050995    JAV75219.1    GEZM01102055    GEZM01102054    GEZM01102053    GEZM01102051    JAV52011.1    KK122208    KFM82237.1    GEZM01079607    GEZM01079598    JAV62391.1    ACPB03023527    GEZM01043682    JAV78912.1    MRZV01000618    PIK46835.1    CM004469    OCT91956.1    GEZM01097791    JAV54106.1    HADY01023564    SBP62049.1    ABLF02041541    MRZV01000245    PIK54530.1    MRZV01000347    PIK51998.1    KQ982635    KYQ53341.1    GFPF01012437    MAA23583.1    ABLF02008619    GEZM01060849    JAV70854.1    GCES01137294    JAQ49028.1    KQ978837    KYN27997.1    GEZM01011167    JAV93615.1   
Pfam
PF17921   Integrase_H2C2        + More
PF17919   RT_RNaseH_2
PF00078   RVT_1
PF00665   rve
PF00412   LIM
PF02209   VHP
PF17917   RT_RNaseH
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR001878   Znf_CCHC       
IPR012337   RNaseH-like_sf       
IPR000477   RT_dom       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR001995   Peptidase_A2_cat       
IPR001969   Aspartic_peptidase_AS       
IPR001781   Znf_LIM       
IPR003128   Villin_headpiece       
IPR036886   Villin_headpiece_dom_sf       
IPR036875   Znf_CCHC_sf       
IPR041373   RT_RNaseH       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
SSF47050   SSF47050       
SSF57756   SSF57756       
Gene 3D
PDB
2BL6     E-value=0.0371663,     Score=85

Ontologies

Topology

Length:
313
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.104
Exp number, first 60 AAs:
0.0965599999999999
Total prob of N-in:
0.05387
outside
1  -  313
 
 

Population Genetic Test Statistics

Pi
230.308268
Theta
209.347594
Tajima's D
0.315212
CLR
0
CSRT
0.455227238638068
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号