SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03358
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 3.426
 

Sequence

CDS
ATGGCGCAAATGATTTTATATTTCATGATGTCCAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGGCTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCCATAATCCCATTCTCACGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGCATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGGTCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAACGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MAQMILYFMMSKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQRRAVRIVHNPILTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLNGRQRLGSAPGIAEVHGRR

Summary

EMBL
AB126052    BAD86652.1    AY359886    AAQ57129.1    FM995623    CAX36785.1    + More
ODYU01007424    SOQ50185.1    ODYU01002162    SOQ39302.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    ODYU01000366    SOQ35027.1    DPOC01000269    HCX22453.1    LWDP01000391    ORD92879.1    GDRN01105059    JAI57791.1    ODYU01004409    SOQ44252.1    ODYU01011959    SOQ58001.1    ODYU01007423    SOQ50184.1    ODYU01006795    SOQ48973.1    ODYU01003793    SOQ42997.1    GFAC01000919    JAT98269.1    GBZX01002173    JAG90567.1    MRZV01001153    PIK40187.1    GFAA01000199    JAU03236.1    AAGJ04079835    GEGO01004630    JAR90774.1    AAGJ04112043    GEFM01001453    JAP74343.1    GFAA01002385    JAU01050.1    MRZV01000414    PIK50568.1    GEGO01001118    JAR94286.1    GFAC01000877    JAT98311.1    GFAA01002657    JAU00778.1    GFAA01002479    JAU00956.1    GFAC01005670    JAT93518.1    KL218275    KFP03813.1    GFAC01005665    JAT93523.1    GEFM01001613    JAP74183.1    KL217824    KFO99526.1    KL217898    KFO99982.1    KL217887    KFO99825.1    AAGJ04095885    KL218790    KFP08260.1    GADI01003787    JAA70021.1    KL217819    KFO99425.1    JARK01001381    EYC12952.1    QRBI01000131    RMC03475.1    KZ505886    PKU43598.1    GFAA01002514    JAU00921.1    KL217820    KFO99518.1    GFAC01005646    JAT93542.1    KL218170    KFP02963.1    NSIT01000239    PJE78188.1    KL217834    KFO99597.1    EYC12953.1    KL217628    KFO97213.1    KL218794    KFP08560.1    KL218253    KFP03498.1    KFO99393.1    KL218510    KFP06135.1    KFP08540.1    KL218506    KL218617    KL218759    KFP03494.1    KFP06081.1    KFP07017.1    KFP07846.1    KL218043    KFP01746.1    KL218277    KFP03922.1    AGCU01000442    GBBK01004986    JAC19496.1    KL218031    KFP01551.1    KL217787    KFO98521.1    KL218648    KFP07340.1    AGCU01035999    KL217644    KFO97377.1    GEFM01002324    JAP73472.1    KL218469    KFP05572.1    AGCU01122093    KL217728    KFO98090.1    GANP01010920    JAB73548.1    GEFM01006417    JAP69379.1    AGCU01082246    AAGJ04028970    GEGO01003594    JAR91810.1    KL218761    KFP07876.1    KFO99295.1    GEGO01002025    JAR93379.1    KL217836    KFO99637.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF08159   NUC153
PF02182   SAD_SRA
PF00097   zf-C3HC4
PF16030   GD_N
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR013083   Znf_RING/FYVE/PHD       
IPR036987   SRA-YDG_sf       
IPR018957   Znf_C3HC4_RING-type       
IPR015947   PUA-like_sf       
IPR017907   Znf_RING_CS       
IPR001841   Znf_RING       
IPR003105   SRA_YDG       
IPR031986   GD_N       
SUPFAM
SSF56219   SSF56219        + More
SSF50978   SSF50978       
SSF88697   SSF88697       
Gene 3D

Ontologies

Topology

Subcellular location
Nucleus  
Length:
197
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00472999999999999
Exp number, first 60 AAs:
0.00459999999999999
Total prob of N-in:
0.05943
outside
1  -  197
 
 

Population Genetic Test Statistics

Pi
341.620293
Theta
186.543895
Tajima's D
2.36353
CLR
0.526459
CSRT
0.930503474826259
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号