SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03247
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.944
 

Sequence

CDS
ATGACAGTTAAAAAAAGGAAAAGGGTTTTGTCGGCGATGCCCCATTCCACATTTAATGTGGATTTCAGCAATGTAAGGGGCCTACATAGTAACCTCGACGCCGTACACCACCATCTTGAGACGGCGCAGCCTGCCCTCCTTTTTCTGACGGAGACACAGATATCTGCTCCGGATGACACTTCGTACCTTGAATACCCCGGCTACGTATTGGAGCACAACTTCCTGCGTAAAGCCGGGGTGTGTGTATTCGTCCGGGCTGATGTCTGTTGTCGCCGTCTACGAGGCCTCGAACAACGGGACCTGTCCATCTTGTGGCTGCGCGTAGATCACGGGGGTTGTACCCGAGTCTACGCGTGCCTGTACAGGTCCCACAGCAGTGATGCAGGTTCAGCTCTGATAGAGCATGTGCAAGAGGGGACTAACCGCGTGCTTGAGCAGTACCCATCTGCGGAGGTGGTGGTTCTTGGAGACTTTAACGCTCACCACCAAGAGTGGTTGGGGTCCAGAACCACTGACCTCCCGGGTCGGGCTGCCTACGATTTCGCCCTGGCCTACGGCTTCTCCCAGCTGGTGACAGAGCCCACCCGTGTCCCAGATATTGAGGGGCACGAGCCCTCTCTGTTGGACCTTCTGCTGACCACCGATCCAGCCGGATACAGTGTGGTGGTCGACGCTCCACTTGGATCGTCTGATCACTGCCTTATCCGTGCTGCGGTACCGATCTCTCGTCCTGGTCGTCGAATGATGACCGGGTATCGAAGAGTTTGGCGGTATATGTCAGCAGATTGGGATGGGTTGCGTGAATTTTACGCATCCTACCCATGGGGGCGGCTCTGCTTTTCCTCTGGTGATCCTGACGTCTGTGCGGACCGACTTAAAAACGTGGTGCTTCGGGGGATGGAACTGTTCATTCCTTCTTCCGAGGTGCCCGTCGGGGGTCGCAGTGGACCCTGGTATAACAATGCCAGTCGGGACGCTGCACGCCTCAAGCGGTCCGCATACGCGGCATGGAATGATGCCAGGAGACGCCAGGATCCTAATACCTCAGAGGAAAGGCGGAAATTTAACGCCGCTTCTAGGTCCTATAAGAGGGCTATTGCCAGGGCGAAGTCGGAGCACGTTGCCAGAATTGGCGAGCGACTGAAGAGCTATCCCGCCGGGAGCCGTGCTTTCTGGTCGCTCGCTAAGGCTGCAGAAGGTAACTTCTGCAGGTCTAGTCTCCCACCACTACGCAAGTCTGATGACAGTCTGGCCCATAGTGCGAAAGAGAAGGCTGACCTTCTGGTCAAACTCTTCGCCTCGAACTCGACTGTGGACGACGGGGGTGCCACACCACCGAACATCCCCCGGTGTGACAGTTCCCTGCCGGAGATCTGCTTTACACAGTGTGCAGTCAGGCGGGAACTCCGACTCCTGGACGTCCATAAGTCGAGTGGGCCGGACGGCATCCCTGCTGTGGTTCTGAAAAGGTGA
Protein
MTVKKRKRVLSAMPHSTFNVDFSNVRGLHSNLDAVHHHLETAQPALLFLTETQISAPDDTSYLEYPGYVLEHNFLRKAGVCVFVRADVCCRRLRGLEQRDLSILWLRVDHGGCTRVYACLYRSHSSDAGSALIEHVQEGTNRVLEQYPSAEVVVLGDFNAHHQEWLGSRTTDLPGRAAYDFALAYGFSQLVTEPTRVPDIEGHEPSLLDLLLTTDPAGYSVVVDAPLGSSDHCLIRAAVPISRPGRRMMTGYRRVWRYMSADWDGLREFYASYPWGRLCFSSGDPDVCADRLKNVVLRGMELFIPSSEVPVGGRSGPWYNNASRDAARLKRSAYAAWNDARRRQDPNTSEERRKFNAASRSYKRAIARAKSEHVARIGERLKSYPAGSRAFWSLAKAAEGNFCRSSLPPLRKSDDSLAHSAKEKADLLVKLFASNSTVDDGGATPPNIPRCDSSLPEICFTQCAVRRELRLLDVHKSSGPDGIPAVVLKR

Summary

EMBL
AY359886    AAQ57129.1    DPOC01000269    HCX22453.1    HAAD01000593    CDG66825.1    + More
NSIT01000234    PJE78200.1    GDRN01111278    JAI56803.1    GDRN01111277    JAI56804.1    AAGJ04114595    NSIT01000225    PJE78229.1    GEGO01003370    JAR92034.1    GEGO01003274    JAR92130.1    NSIT01000383    PJE77769.1    KQ971357    EFA08424.1    AAGJ04060226    GG695857    EFA13460.1    GEGO01004865    JAR90539.1    GDRN01111326    JAI56798.1    AAGJ04103823    AH011247    AAL40415.1    DNUT01000434    HBI40906.1    NSIT01000271    PJE78081.1    AAGJ04015404    AAGJ04111627    NSIT01000300    PJE77993.1    GEGO01007351    JAR88053.1    LSMT01000899    PFX13773.1    LSMT01000767    PFX14526.1    EFA08429.1    NSIT01000218    PJE78267.1    AAGJ04029969    NSIT01000294    PJE78013.1    NSIT01000164    PJE78524.1    LSMT01000907    PFX13730.1    EFA08423.1    LSMT01000661    PFX15311.1    LSMT01000174    PFX24547.1    LSMT01001623    PFX12055.1    NEDP02004020    OWF47171.1    GEGO01004596    JAR90808.1    GEGO01002277    JAR93127.1    LSMT01000412    PFX18406.1    PFX13731.1    GEFM01005848    JAP69948.1    LSMT01000295    PFX21010.1    AAGJ04167750    GEEE01008367    JAP54858.1    GEGO01004477    JAR90927.1    GEFM01002301    JAP73495.1    GEGO01003776    JAR91628.1    GEGO01004441    JAR90963.1    DS268433    EFO97776.1    AAGJ04110620    GEGO01003111    JAR92293.1    LSMT01000046    PFX30727.1    GFAC01000857    JAT98331.1    LSMT01001965    PFX11729.1    LSMT01000121    PFX26660.1    LSMT01000769    PFX14518.1    GEGO01002473    JAR92931.1    DS497938    EFA12429.1    DS268409    EFO94840.1    GFAC01000913    JAT98275.1    EFA13459.1    DS497963    EFA12534.1    GACK01003890    JAA61144.1    GCES01007896    JAR78427.1    LSMT01000001    PFX34902.1    QRBI01000093    RMC21672.1    GEGO01003567    JAR91837.1    GACK01009888    JAA55146.1    GEGO01003594    JAR91810.1    GEGO01005479    JAR89925.1    GEGO01004518    JAR90886.1    GACK01003881    JAA61153.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF02460   Patched
PF00096   zf-C2H2
PF03372   Exo_endo_phos
PF00884   Sulfatase
PF12017   Tnp_P_element
PF17919   RT_RNaseH_2
PF17921   Integrase_H2C2
PF00665   rve
PF00350   Dynamin_N
PF07714   Pkinase_Tyr
PF05380   Peptidase_A17
PF00595   PDZ
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR030223   Dispatched       
IPR003392   Ptc/Disp       
IPR000731   SSD       
IPR011011   Znf_FYVE_PHD       
IPR013083   Znf_RING/FYVE/PHD       
IPR019787   Znf_PHD-finger       
IPR019786   Zinc_finger_PHD-type_CS       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR017850   Alkaline_phosphatase_core_sf       
IPR000917   Sulfatase_N       
IPR024607   Sulfatase_CS       
IPR021896   Transposase_37       
IPR035983   Hect_E3_ubiquitin_ligase       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR022812   Dynamin_SF       
IPR008266   Tyr_kinase_AS       
IPR000719   Prot_kinase_dom       
IPR011009   Kinase-like_dom_sf       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR027417   P-loop_NTPase       
IPR011604   Exonuc_phg/RecB_C       
IPR008042   Retrotrans_Pao       
IPR036034   PDZ_sf       
IPR001478   PDZ       
IPR001965   Znf_PHD       
SUPFAM
SSF56219   SSF56219        + More
SSF57903   SSF57903       
SSF57667   SSF57667       
SSF53649   SSF53649       
SSF56204   SSF56204       
SSF53098   SSF53098       
SSF52540   SSF52540       
SSF56112   SSF56112       
SSF50156   SSF50156       

Ontologies

Topology

Length:
490
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0024
Exp number, first 60 AAs:
0.00021
Total prob of N-in:
0.02623
outside
1  -  490
 
 

Population Genetic Test Statistics

Pi
12.673347
Theta
101.678657
Tajima's D
0
CLR
0.046161
CSRT
0.36023198840058
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号