SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03125
Annotation
reverse_ribonuclease_integrase?_partial_[Lasius_niger]
Location in the cell
Mitochondrial   Reliability : 2.139
 

Sequence

CDS
ATGCTCCAGCTTGATGTAGTTGAGCCTTGTGAGAGTGCCTGGCAATCCCCGGTATTGTTAGTCACTAAAAAAGATGGTCAGCCACGGTTTTGCTTAGATAGTAGGAAGCTAAACTCTGTTACGAAACGTGACGCTTATAACTTACCTTACATATCGGAGATATTGGACAACTTGCGAGACGCGCGCTATCTTAGCAGTATTGACTTATCAAAGGCTTTCTGGCAATTACCAATAGCACTCGAAGATAGGGACAAGACGGCATTTTACGTTCCGGGACGAGGGACGTTACGGTTCAAGACTACACCGTTTGGTTTGACCAATGCGCCTTCTACGCAACAGCGGTTAGTCGATTTATTGTTTGGCAACATGGATCACAAGGCGTTCGCATATTTAGATGATGTGATAATAGTAAGTAGCACGTTTGATGAGCATGTTAGTCTTCTTCTTCGCGTGTTAGACAAACTGCGCCATGCTAATCTAACAATTAATTTAGAAAAGTGTGAATTTTTTCGAAGTAAACTTAAATATTTAGGCTATGTGGTCGACGCGAATGGTTTGCGGACTGATCCGGATAAAGTTACAGCCATTCTAAATTACCCAACTCCTACATGTCGTAAGGACTTGAAACGGTTCCTAGGCACGGCAACATGGTACCGGAGATTTGTCCCAAACTTTAGCACTATCGCAGGGCCGCTTAATAGGTTGACATCGAACAAAAAATCAACACATCCCTTCCAGTGGACAGATGAGGCCGACACTGCGTTCAAAAAACTTAAGGAATCTTTGGTCTCGGCACCTGTTCTCTCCTGCCCAAATTATGATCTGCCTTTCGAAGTCCATACAGATGCAAGTAACTATGGGATAGGTGGTATGCTCACACAAACTATTGACGGGAAAGAGCACCCTATAGCGTATATGAGTAAGTCCTTATCGGGGGCCGAAAAGAATTATAGCATTACCGAACGTGAGACCTTAGCTGTTCTCGTGGCTCTCGAGCACTGGCGTTGCTATCTGGAGAACGGAAAGACATTCACGGTTTACACAGACCACAGCGCACTTAAGTGGTTCCTTTCCTTGAACAATCCTACGGGTAGGCTTGCACGTTGGGGAGTTCGATTATCGTCGTTTGATTTTGAAATCAAACACCGCCGCGGTGTAGACAATGTGATTCCCGACGCTTTGTCTAGAGCTGTCCCGGTCACTACTATCACTACTGCTAAATCACTCACGACTTCTAGTGATGATTGAAAGCCTTTTGAATTTAATGTAGGAGATACTGTTTATAAACGCGCTTACGTCCTGAGTGACAAAGATAAGTATTTTAGTAAGAAGTTAGCACCGAAATATATCAAGTGCAAAGTTGTCGAAAAACTCTCGCCACTTGTCTACGTCCTAGAAGACATGTCGGGTAAAAACATAGGCACTTGGCATATTAAAGACTTGAAAATATTAGGACAACACTCATAG
Protein
MLQLDVVEPCESAWQSPVLLVTKKDGQPRFCLDSRKLNSVTKRDAYNLPYISEILDNLRDARYLSSIDLSKAFWQLPIALEDRDKTAFYVPGRGTLRFKTTPFGLTNAPSTQQRLVDLLFGNMDHKAFAYLDDVIIVSSTFDEHVSLLLRVLDKLRHANLTINLEKCEFFRSKLKYLGYVVDANGLRTDPDKVTAILNYPTPTCRKDLKRFLGTATWYRRFVPNFSTIAGPLNRLTSNKKSTHPFQWTDEADTAFKKLKESLVSAPVLSCPNYDLPFEVHTDASNYGIGGMLTQTIDGKEHPIAYMSKSLSGAEKNYSITERETLAVLVALEHWRCYLENGKTFTVYTDHSALKWFLSLNNPTGRLARWGVRLSSFDFEIKHRRGVDNVIPDALSRAVPVTTITTAKSLTTSSDDXKPFEFNVGDTVYKRAYVLSDKDKYFSKKLAPKYIKCKVVEKLSPLVYVLEDMSGKNIGTWHIKDLKILGQHS

Summary

EMBL
GEZM01035170    JAV83377.1    GALX01000704    JAB67762.1    GDHC01008563    JAQ10066.1    + More
GEZM01035168    JAV83378.1    GEZM01001047    JAV98195.1    GEZM01099475    JAV53313.1    GEZM01099943    GEZM01099942    GEZM01099938    JAV53086.1    GBHO01041895    GBHO01025146    GBHO01025145    GBHO01025144    GBHO01025143    GBHO01014600    GBHO01014569    JAG01709.1    JAG18458.1    JAG18459.1    JAG18460.1    JAG18461.1    JAG29004.1    JAG29035.1    GEBQ01007184    GEBQ01002795    JAT32793.1    JAT37182.1    LBMM01018582    KMQ83753.1    GEZM01100409    GEZM01100408    GEZM01100407    GEZM01100406    GEZM01100404    GEZM01100403    JAV52889.1    GEZM01099692    JAV53185.1    LBMM01016885    KMQ84279.1    GEZM01099479    JAV53309.1    GAMC01020690    JAB85865.1    GEBQ01014606    JAT25371.1    GEZM01046053    JAV77555.1    GEZM01019359    JAV89692.1    GFTR01008544    JAW07882.1    GBBI01004690    JAC14022.1    GFTR01008516    JAW07910.1    LBMM01010645    KMQ87338.1    GEZM01033784    GEZM01033783    GEZM01033781    GEZM01033780    GEZM01033779    GEZM01033777    GEZM01033776    GEZM01033775    GEZM01033774    GEZM01033773    GEZM01033772    JAV84145.1    GALX01005179    JAB63287.1    GFTR01008518    JAW07908.1    GFTR01008424    JAW08002.1    GEZM01073925    JAV64737.1    GBYB01006259    JAG76026.1    GECU01030157    GECU01020076    JAS77549.1    JAS87630.1    LBMM01012378    KMQ86252.1    GBHO01008766    JAG34838.1    KQ971350    KYB26855.1    LBMM01010852    KMQ87188.1    LBMM01010896    KMQ87169.1    GBBI01004637    JAC14075.1    GEZM01005662    GEZM01005661    JAV96000.1    LBMM01011454    KMQ86828.1    LBMM01004568    KMQ92283.1    GFTR01008089    JAW08337.1    JXUM01014148    KQ560395    KXJ82633.1    LBMM01009042    KMQ88444.1    LBMM01009043    KMQ88443.1    KQ972957    KXZ75714.1    GALX01005355    JAB63111.1    GEZM01083034    JAV61205.1    GEZM01020516    GEZM01020515    JAV89256.1    LBMM01011641    KMQ86727.1    GFTR01008489    JAW07937.1    LBMM01013676    KMQ85528.1    GEZM01018686    JAV90062.1    GEZM01018688    GEZM01018687    GEZM01018685    GEZM01018684    GEZM01018683    GEZM01018682    JAV90067.1    GBHO01002002    GBHO01001990    JAG41602.1    JAG41614.1    GBHO01042757    JAG00847.1    LBMM01014647    KMQ85099.1    GBHO01043356    JAG00248.1    GDHC01020090    JAP98538.1    LBMM01017485    KMQ84071.1    GDHC01010105    JAQ08524.1    GECL01003261    JAP02863.1    LBMM01014329    KMQ85218.1    GEZM01046161    JAV77473.1    GDHC01007507    JAQ11122.1    GFTR01008241    JAW08185.1    KQ972733    KXZ75794.1    CH892681    KRK05548.1    LBMM01017182    KMQ84177.1    GBBI01004634    JAC14078.1    AAZX01023814    GAMC01011885    GAMC01011883    JAB94672.1    GBYB01001213    JAG70980.1    AAZX01004227    LBMM01014677    KMQ85083.1    KK112080    KFM56688.1    KK113242    KFM59673.1    JXUM01028079    KQ560809    KXJ80804.1    GFJQ02008169    JAV98800.1    AJ133521    CAB39733.1    DQ408427    ABD72267.1    LBMM01015374    KMQ84832.1    GBYX01214978    JAO74495.1    KK113062    KFM59232.1    LBMM01015404    KMQ84823.1    LN877232    CTR11712.1    GEHC01000926    JAV46719.1    GBYX01214976    JAO74497.1    GACK01000610    JAA64424.1    GDIP01038436    JAM65279.1    LBMM01003245    KMQ93756.1    GECU01004320    JAT03387.1    GEGO01001548    JAR93856.1    GEDC01004851    JAS32447.1    GFDF01007737    JAV06347.1    AAGJ04130933    AAZX01023348    GACK01009937    JAA55097.1    MRZV01001284    PIK39040.1    MRZV01000315    PIK52746.1   
Pfam
PF17917   RT_RNaseH        + More
PF00078   RVT_1
PF17921   Integrase_H2C2
PF00665   rve
PF17919   RT_RNaseH_2
PF00098   zf-CCHC
PF00077   RVP
PF03732   Retrotrans_gag
PF12017   Tnp_P_element
PF09668   Asp_protease
PF13358   DDE_3
PF01498   HTH_Tnp_Tc3_2
PF00628   PHD
PF02023   SCAN
Interpro
IPR041373   RT_RNaseH        + More
IPR000477   RT_dom       
IPR001969   Aspartic_peptidase_AS       
IPR021109   Peptidase_aspartic_dom_sf       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR001584   Integrase_cat-core       
IPR012337   RNaseH-like_sf       
IPR041577   RT_RNaseH_2       
IPR001995   Peptidase_A2_cat       
IPR034122   Retropepsin-like_bacterial       
IPR036875   Znf_CCHC_sf       
IPR001878   Znf_CCHC       
IPR018061   Retropepsins       
IPR005162   Retrotrans_gag_dom       
IPR003034   SAP_dom       
IPR021896   Transposase_37       
IPR019103   Peptidase_aspartic_DDI1-type       
IPR036361   SAP_dom_sf       
IPR002492   Transposase_Tc1-like       
IPR009057   Homeobox-like_sf       
IPR038717   Tc1-like_DDE_dom       
IPR011011   Znf_FYVE_PHD       
IPR013083   Znf_RING/FYVE/PHD       
IPR001965   Znf_PHD       
IPR003309   SCAN_dom       
IPR019787   Znf_PHD-finger       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
SSF57756   SSF57756       
SSF68906   SSF68906       
SSF46689   SSF46689       
SSF57903   SSF57903       
PDB
4OL8     E-value=1.48366e-70,     Score=677

Ontologies

Topology

Length:
488
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00063
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00080
outside
1  -  488
 
 

Population Genetic Test Statistics

Pi
13.553717
Theta
20.650132
Tajima's D
-1.387926
CLR
140.123041
CSRT
0.072196390180491
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号