SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03039
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.885
 

Sequence

CDS
ATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAACTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACAAAGACTGGCCCTCCTCCAGTCCAGATTGGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCGATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCATAATCACGGAGGTCATTTTAAATAA
Protein
MFNNRHWVFQQDSAPTHRAKSTQDWLAAREIDFIRHKDWPSSSPDWNPLDYKIWQHLEEKACSKPHPDLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIHNHGGHFK

Summary

EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB473770    BAH20555.1    + More
AB363006    AB363010    AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    U47917    AAB47739.1    LNIX01000030    OXA41211.1    UYSL01022144    VDL79905.1    UYSL01002425    VDL65835.1    JF779677    AEO90418.1    PDUG01000005    PIC23776.1    UYSL01009772    VDL68385.1    UYSL01020634    VDL75527.1    JARK01001658    EYB84158.1    KN729202    KIH62598.1    DS268612    EFO94085.1    PDUG01000006    PIC20538.1    JARK01001601    EYB87313.1    UYSL01019905    VDL71189.1    CAVP010058755    CDL95145.1    UYSL01023059    VDL81638.1    JARK01000255    EYC39473.1    DS268747    EFP00909.1    JOJR01000015    RCN51257.1    UYSL01019770    VDL69590.1    JARK01001471    EYB97976.1    DS268433    EFO97645.1    DS268420    EFO87874.1    PDUG01000001    PIC51673.1    JARK01001411    EYC06502.1    KI662043    ETN73029.1    JARK01001337    EYC34439.1    UYSL01021399    VDL78127.1    JOJR01000583    RCN36166.1    UYSL01019810    VDL70150.1    PIC29926.1    UZAH01026445    VDO80847.1    DS268492    EFP11689.1    EFP11674.1    DS268466    EFP06959.1    DS268508    EFO83264.1    DS268606    EFO93488.1    DS268428    EFO94379.1    PDUG01000012    PIC13506.1    DS268421    EFO88618.1    DS268673    EFO98001.1    UYSL01023743    VDL82626.1    DS268679    EFO98285.1    JARK01001418    EYC05389.1    DS268525    EFO85497.1    UYSL01020109    VDL72812.1    DS268565    EFO90304.1    UZAH01001595    VDO19836.1    DS268539    EFO88027.1    UYSL01021347    VDL77984.1    PDUG01000004    PIC32571.1    KN726559    KIH67820.1    JARK01000059    EYC44525.1    UYSL01020631    VDL75518.1    UZAH01031030    VDP13493.1    KN728435    KIH63782.1    UYSL01020934    VDL76658.1    DS268545    EFO88382.1    HE601413    CAS00486.1    JARK01000176    EYC41234.1    JARK01001345    EYC27589.1    KN726483    KIH68032.1    KN733186    KIH58375.1    CAVP010058332    CDL94449.1    PIC32570.1    PIC28734.1    JARK01001350    EYC23962.1   
Pfam
PF13358   DDE_3        + More
PF00292   PAX
PF10320   7TM_GPCR_Srsx
PF00001   7tm_1
PF00250   Forkhead
Interpro
IPR009057   Homeobox-like_sf        + More
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR036906   ATPase_V1_fsu_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
IPR036390   WH_DNA-bd_sf       
IPR001766   Fork_head_dom       
IPR030456   TF_fork_head_CS_2       
SUPFAM
SSF46689   SSF46689        + More
SSF46785   SSF46785       
Gene 3D
PDB
5CR4     E-value=7.68997e-07,     Score=120

Ontologies

Topology

Subcellular location
Nucleus  
Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.31101
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
180.560925
Theta
141.848092
Tajima's D
0.85767
CLR
0
CSRT
0.618269086545673
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号