SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO03025
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.545 Nuclear   Reliability : 2.012
 

Sequence

CDS
ATGACTTACGGTTCCGAGACGTGGTGCTTCACAAGGGATCTTTTCAGGAAGCTTAGTGTCGCGCAGCGAGCTATGGAGAGGGCTATGCTTGGTATTTCTCTACGAGATCGAATCAGAAATGAGGAGATCCGTAGAAGAACCAAAGTTGCTGACATAGCCCGTAGGATTAGCAAGCTGAAGTGGCAGTGGGCTGGCCACATAGCGCGAAGATCGGACGGCCGATGGGGCAGAAAGATCCTCGAGTGGAGACCACGTACTGGCAAACGCAGTGTGGGACGGCCACCTACCAGATGGACCGACGACCTGGTGAAAATTGCTGGGTCACGTTGGATGCAGGTGGCAACGGACCGGCCGCACTGGACATCAGTTGGAGAGGCCTATGTTCAGCAGTGGACAGAAGACAGGCTGAAATGA
Protein
MTYGSETWCFTRDLFRKLSVAQRAMERAMLGISLRDRIRNEEIRRRTKVADIARRISKLKWQWAGHIARRSDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKIAGSRWMQVATDRPHWTSVGEAYVQQWTEDRLK

Summary

EMBL
FJ265544    ADI61812.1    FJ265543    ADI61811.1    EF113399    EF113400    + More
ABO45233.1    EF113398    EF113401    ABO45231.1    EF113402    ABO45239.1    FJ265549    ADI61817.1    FJ265542    ADI61810.1    KZ150072    PZC74016.1    FJ265545    ADI61813.1    FJ265551    ADI61819.1    FJ265550    ADI61818.1    KZ150065    PZC74169.1    ODYU01008431    SOQ52031.1    KZ149953    PZC76544.1    ODYU01009605    SOQ54153.1    ODYU01011862    SOQ57848.1    ODYU01003998    SOQ43428.1    KZ149985    PZC75698.1    GBBI01004876    JAC13836.1    KZ150485    PZC70710.1    NWSH01003335    PCG66527.1    FJ265564    ADI61832.1    FJ265563    ADI61831.1    KZ150286    PZC71609.1    GEDV01010296    JAP78261.1    GL440455    EFN65840.1    JPKZ01004123    KHN71972.1    FJ265561    ADI61829.1    JPKZ01001394    KHN82224.1    MRZV01000786    PIK44294.1    LBMM01002200    KMQ95153.1    JPKZ01002932    KHN74308.1    MRZV01002136    PIK34564.1    KZ150317    PZC71439.1    ODYU01000693    SOQ35892.1    KZ150108    PZC73382.1    GEDV01000518    JAP88039.1    NWSH01004509    PCG65028.1    MRZV01001865    PIK35593.1    FJ265562    ADI61830.1    AAGJ04035986    KZ149912    PZC78089.1    JPKZ01002136    KHN78309.1    GBBI01004877    JAC13835.1    AAGJ04011852    GDKW01001596    JAI54999.1    AAGJ04005502    JPKZ01001456    KHN81799.1    AAGJ04065374    AAGJ04144474    AAGJ04012759    MRZV01000899    PIK42833.1    JARK01001338    EYC32701.1    EYC32700.1    GFAA01002978    JAU00457.1    GBGD01002934    JAC85955.1    ODYU01004982    SOQ45402.1    GFPF01007585    MAA18731.1    AAGJ04112759    UYWY01020264    VDM41049.1    GBGD01000453    JAC88436.1    JARK01000732    EYC35149.1    ODYU01006342    SOQ48110.1    DS268655    EFO97114.1    JARK01001565    EYB89683.1    JARK01001337    EYC34625.1    JARK01001676    JARK01001446    JARK01001433    EYB83199.1    EYC01126.1    EYC02928.1    DS268591    EFO92565.1    ODYU01008030    SOQ51293.1    AAGJ04013248    DS268453    EFP04265.1    DS269613    EFO86468.1    DS268410    EFO99851.1    DS269226    EFP10832.1    DS268505    EFP13372.1    DS268448    EFP02560.1    DS269097    EFP08676.1    DS268794    EFP02105.1    DS268444    EFP01729.1    AAGJ04112537    DS268581    EFO91764.1    DS269943    EFO90109.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF03385   STELLO
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR005049   STL-like       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
137
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00034
Exp number, first 60 AAs:
0.00034
Total prob of N-in:
0.20821
outside
1  -  137
 
 

Population Genetic Test Statistics

Pi
329.128172
Theta
183.911586
Tajima's D
2.484541
CLR
0
CSRT
0.941402929853507
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号