SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02956  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA003567
Annotation
alkaliphilic_serine_protease_[Bombyx_mori]
Full name
Trypsin, alkaline A       + More
Trypsin, alkaline C      
Trypsin, alkaline B      
Trypsin CFT-1      
Location in the cell
Extracellular   Reliability : 4.75
 

Sequence

CDS
ATGCGGTCTACCATTATTTTGTTGGCCCTTGGGCTTGCTGCTGTGGCGGCTGTTCCTACCAACCCACAAAGGATTATTGGTGGCTCCACGACCAACATTAACCAGTATCCCGGTATAGCTGCTTTGTTGTATACATGGAATTGGAATCAGTGGTGGCAGTCTTGTGGTGGAAACATCCTTAACCAGAGATCTATCCTTAGTGCCGCTCACTGTCCATACGGTGACGCTACAGGCCGTTGGCGTATTCGTGTTGGTTCCACCTTTGCCAACAGTGGGGGTGTTGTGCATAACGTGAACAGAATTATCATTCATCCCAACTATAACAGACGTACTGCTGACAGTGACCTCTGCATCTTACGCAGTAATTCCAACATAGCTTATAACAACAACGTTCGTCCTATTAATATTGCTGGTGCCAATTACAATCTTGGTGATAACCAAGTTGTTTGGGCTGCTGGTTGGGGTGCTACATCGCTCGGAGGGTCTAATTCGGAGCAACTCCGTCACGTCCAGGTCTGGACCATCAATCAGAATGCCTGCGTCCAACGTTACAGACCCATTAACCGTGCTATCACCGCTAACATGTTGTGCTCTGGTGTTTTGGACGTCGGTGGTCGCGACCAGTGCCAGGGTGACTCCGGTGGTCCTCTCCTCCACAACCGCGTCCTCGTTGGTGTCTGCTCTTGGGGACAGTACTGCGCTGACCGTCGCTTCCCTGGTGTTAACGTTCGCGTTTCCCGTTTCACCTCTTGGATCCAATCCAATTCGTAA
Protein
MRSTIILLALGLAAVAAVPTNPQRIIGGSTTNINQYPGIAALLYTWNWNQWWQSCGGNILNQRSILSAAHCPYGDATGRWRIRVGSTFANSGGVVHNVNRIIIHPNYNRRTADSDLCILRSNSNIAYNNNVRPINIAGANYNLGDNQVVWAAGWGATSLGGSNSEQLRHVQVWTINQNACVQRYRPINRAITANMLCSGVLDVGGRDQCQGDSGGPLLHNRVLVGVCSWGQYCADRRFPGVNVRVSRFTSWIQSNS

Summary

Catalytic Activity
Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.
Similarity
Belongs to the peptidase S1 family.
Keywords
Disulfide bond   Hydrolase   Protease   Secreted   Serine protease   Signal   Zymogen   Direct protein sequencing  
Feature
propeptide  Activation peptide
chain  Trypsin, alkaline A
EC Number
3.4.21.4
EMBL
BABH01007517    JX312360    AFQ59994.1    BABH01007520    L16805    L16807    + More
KY379952    APS85762.1    KQ459597    KPI95066.1    L16806    U12917    AAA84423.1    L04749    MF407317    AWL83213.1    KPI95071.1    KPI95067.1    KQ460226    KPJ16474.1    AY040819    AAK81696.1    EF531631    EF531633    ABR88242.1    ABR88244.1    NWSH01000106    PCG79485.1    EF531632    ABR88243.1    PCG79488.1    EF531637    ABR88248.1    HM209426    Y12283    KZ150104    ADI32887.1    CAA72962.1    PZC73444.1    PCG79486.1    FJ205402    ACR15970.1    JX866720    AGB93875.1    PCG79474.1    JX195651    AFQ37934.1    AY587161    AAT95353.1    AJ007706    CAA07611.1    KPI95074.1    ODYU01002655    SOQ40442.1    PCG79472.1    KPJ16473.1    KC175562    AGR92345.1    KZ150747    PZC70337.1    PCG79475.1    PCG79487.1    KZ149992    PZC75527.1    KPI95068.1    PZC70335.1    BABH01007514    BABH01007515    ODYU01003655    SOQ42698.1    BABH01007473    KPI95070.1    AY587159    AAT95351.1    JX195649    AFQ37932.1    KM360188    AKH49604.1    Y12269    CAA72948.1    PZC73449.1    EF531636    ABR88247.1    PCG79483.1    AY587145    AAT95360.1    KU302250    AOQ30448.1    EF104916    Y12271    ABP96918.1    CAA72950.1    PZC73450.1    PZC75529.1    PZC73448.1    PZC75528.1    PCG79490.1    EF635223    ABU96714.1    JX195652    AFQ37935.1    JX046916    AFO83992.1    PZC73453.1    PCG79473.1    GBRD01013231    JAG52595.1    PZC73441.1    PZC70338.1    HM990174    ADT80822.1    PCG79493.1    PCG79484.1    FJ940726    ODYU01006287    ACR25157.1    SOQ47996.1    PZC73443.1    KF779933    AHI07442.1    JN793539    AFO68319.1    KPI95069.1    AF064525    AF064526    AAC36247.1    AAC36248.1    JQ340915    AFP74111.1    AY953061    AAX62034.1    ODYU01007611    SOQ47997.1    SOQ50538.1    JN793542    AFO68322.1    PZC75526.1    HM209425    ADI32886.1    PCG79476.1    AY953059    AAX62032.1    AY587157    AAT95349.1    AY953063    AAX62036.1    Y12270    CAA72949.1    AY513649    AAR98918.1    PCG79482.1    HM209423    ADI32884.1    ODYU01009856    SOQ54559.1    PZC73442.1    AY953062    AAX62035.1    AY587146    AAT95361.1    AY953060    AAX62033.1    AY587147    AAT95362.1    PZC70336.1    HM209424    ADI32885.1    PCG79481.1    FJ205445    ACR16008.2    JX195648    AFQ37931.1    ODYU01007266    SOQ49895.1   
Pfam
PF00089   Trypsin
Interpro
IPR001254   Trypsin_dom        + More
IPR033116   TRYPSIN_SER       
IPR009003   Peptidase_S1_PA       
IPR001314   Peptidase_S1A       
IPR018114   TRYPSIN_HIS       
SUPFAM
SSF50494   SSF50494       
PDB
1EKB     E-value=2.92483e-29,     Score=318

Ontologies

Topology

Subcellular location
  
SignalP
Position:   1 - 17,         Likelihood:  0.998356
 
 
Length:
256
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.7294
Exp number, first 60 AAs:
3.70564
Total prob of N-in:
0.17413
outside
1  -  256
 
 

Population Genetic Test Statistics

Pi
208.423842
Theta
3.552175
Tajima's D
-1.004291
CLR
31.204866
CSRT
0.130393480325984
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 VGSTFANSGGVVHNVNR 100.00 8e-05
25860555 PAWVTITDIYDSSHR 100.00 1e-04
26280517 VGSCYAYISETGECADR 100.00 1e-04
24093152 VGSAYENVK 100.00 1e-04
24402669 VGSGCDRDTYSIHSQR 100.00 1e-04
27102218 FTSWIQSNS 100.00 1e-04
28556443 VGSTFANSGGVVH 100.00 1e-04
28556443 FLTGPVDFSDK 100.00 1e-04
28556443 FTSWIQSNS 100.00 0.033
28556443 SLGGSNSEQLR 100.00 0.047
28556443 HVQVWTINQNAC 100.00 0.047
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号