SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02947
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.163 Mitochondrial   Reliability : 1.398 Nuclear   Reliability : 1.352
 

Sequence

CDS
ATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCTAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAGGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGCAGGTCATTTTGGATAA
Protein
MFNNRHWVFQQDSALAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSRPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHAGHFG

Summary

EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB473770    BAH20555.1    + More
AB363006    AB363010    AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    U47917    AAB47739.1    LNIX01000030    OXA41211.1    JF779677    AEO90418.1    UYSL01022144    VDL79905.1    PDUG01000005    PIC23776.1    UYSL01002425    VDL65835.1    UYSL01020634    VDL75527.1    DS268612    EFO94085.1    JARK01001601    EYB87313.1    CAVP010058755    CDL95145.1    KN729202    KIH62598.1    UYSL01009772    VDL68385.1    PDUG01000006    PIC20538.1    UYSL01023059    VDL81638.1    DS268433    EFO97645.1    JARK01001658    EYB84158.1    DS268747    EFP00909.1    DS268420    EFO87874.1    KI662043    ETN73029.1    PDUG01000001    PIC51673.1    UYSL01019905    VDL71189.1    PIC29926.1    JOJR01000015    RCN51257.1    JARK01001337    EYC34439.1    JOJR01000583    RCN36166.1    PDUG01000012    PIC13506.1    UZAH01031030    VDP13493.1    DS268492    EFP11689.1    UZAH01026445    VDO80847.1    UYSL01019770    VDL69590.1    EFP11674.1    JARK01001471    EYB97976.1    JARK01001411    EYC06502.1    DS268508    EFO83264.1    DS268565    EFO90304.1    JARK01000255    EYC39473.1    DS268606    EFO93488.1    DS268428    EFO94379.1    DS268525    EFO85497.1    DS268421    EFO88618.1    UYSL01021399    VDL78127.1    DS268466    EFP06959.1    DS268673    EFO98001.1    UZAH01001595    VDO19836.1    DS268679    EFO98285.1    DS268539    EFO88027.1    UYSL01019810    VDL70150.1    UYSL01020631    VDL75518.1    UYSL01020109    VDL72812.1    HE601413    CAS00486.1    JARK01001418    EYC05389.1    KN726559    KIH67820.1    PDUG01000004    PIC32571.1    KN728435    KIH63782.1    UYSL01023743    VDL82626.1    UYSL01021347    VDL77984.1    JARK01000059    EYC44525.1    UYSL01020934    VDL76658.1    DS268545    EFO88382.1    PIC28734.1    UZAH01000669    VDO19161.1    PIC32570.1    JARK01000176    EYC41234.1    JARK01001345    EYC27589.1    KN727674    KIH65166.1    UYSL01022000    VDL79615.1    KN726483    KIH68032.1   
Pfam
PF13358   DDE_3        + More
PF00292   PAX
PF10320   7TM_GPCR_Srsx
PF00250   Forkhead
PF00520   Ion_trans
Interpro
IPR009057   Homeobox-like_sf        + More
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR036906   ATPase_V1_fsu_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
IPR036390   WH_DNA-bd_sf       
IPR001766   Fork_head_dom       
IPR030456   TF_fork_head_CS_2       
IPR005821   Ion_trans_dom       
IPR024862   TRPV       
SUPFAM
SSF46689   SSF46689        + More
SSF46785   SSF46785       
Gene 3D
PDB
5CR4     E-value=9.95707e-08,     Score=128

Ontologies

Topology

Subcellular location
Nucleus  
Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.29405
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
257.048774
Theta
114.853388
Tajima's D
5.983412
CLR
34.932715
CSRT
0.999950002499875
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号