SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02769
Annotation
PREDICTED:_uncharacterized_protein_LOC105386641_[Plutella_xylostella]
Location in the cell
Nuclear   Reliability : 2.765
 

Sequence

CDS
ATGTCATCAGATCCATCTGACTTAACCTTCCTTACGCCCGCCCATTTCCTTATTGGTCGGCCACTCACTTCGGTACCATATCCCGACATCACGGAAGCCAACATCACTCGTCTTCAACGTTTCCAACGAGTTGAAAGCTTAAAGCAACATTTTTGGAGGCGATACTCTAATGAATATGTTTCTCTCTTACAACAGAGATACAAATGGAAAAAATCTTCAGGTCAACTGCGGATCGGTGCAATGGTCATCATCAAGGACAAGACATTGCCGCCAATGATGTGGCTTTTGGGACGAATAGTTCGTCTCGTACATGGCAACGACGGCATCGCGAGGGTTGCTGACATTGCAACCACGAAAGGCATACTACGCCGGGCATACAACAACATATGCCCGCTTCCTGTGGACTCCTCGGAGATCCATATTGAAGAAGACGACTCTTCAACGCCGGGGAGGATGTCCGCGCCAGTACTTCACGTACAAGCGGGGACTACGAGGTCTGCGGGGGGGTCCAACCACCACCACGGCATCGACGACTCGAGCGGCGAGGACGGAACACACACAGCGACACAGAACACTACTGGAACGATATAG
Protein
MSSDPSDLTFLTPAHFLIGRPLTSVPYPDITEANITRLQRFQRVESLKQHFWRRYSNEYVSLLQQRYKWKKSSGQLRIGAMVIIKDKTLPPMMWLLGRIVRLVHGNDGIARVADIATTKGILRRAYNNICPLPVDSSEIHIEEDDSSTPGRMSAPVLHVQAGTTRSAGGSNHHHGIDDSSGEDGTHTATQNTTGTI

Summary

Pfam
PF18701   DUF5641
Interpro
IPR040676   DUF5641       
ProteinModelPortal

Ontologies

GO

Topology

Length:
196
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.02026
Exp number, first 60 AAs:
0.00451
Total prob of N-in:
0.02639
outside
1  -  196
 
 

Population Genetic Test Statistics

Pi
413.43314
Theta
159.437788
Tajima's D
5.009432
CLR
3.460835
CSRT
0.999950002499875
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号