SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02743
Pre Gene Modal
BGIBMGA002210
Annotation
PREDICTED:_uncharacterized_protein_LOC101737771_isoform_X3_[Bombyx_mori]
Transcription factor
Location in the cell
Nuclear   Reliability : 4.244
 

Sequence

CDS
ATGCCTGATACTCATCGTACTTGTGAAGTTTGTGGTATCAAAGAAAGACATCTTACTGAAAAACGGTTTTTCGCAAGGTTTCCTCTGGATGTCAATAGATGTAAACAATGGGTAAAGATGGTTGGCAAAGAAGATCTGGCTTATCTTCAAGTACATATGCTACATGATTTAAAACATGTTTGTGAAGCACATTTCTCAAGACGAGACTTTACAAAATCAAAGAAGCGCTTAAAAAAACGAGCTGTACCCAAACTGAACTTGACACTGCCACCATTGAGAGATGAAATTCTTCTTCAATTTTTGCAACTCAACTCGCAAGCGGATGTCACCCCACAAGGCCAGTTCGAGGTTCAGGCCGTTCCTAGTGCTTTGATGCCAGCATCCTCAAGTCAGCCTAGCGGTCTAGAGAAAACTGATGTCACCCCACAAGGCCAGTTTGAGGTTCAGGCTGTTCCTTGTACTTCAATGCCAACATCCTCAAGTCAGTCTAGCAGTCTAGAGAAAAGTAAGAATCGATTTCATGAAAGCAATTCTAAATTTTAG
Protein
MPDTHRTCEVCGIKERHLTEKRFFARFPLDVNRCKQWVKMVGKEDLAYLQVHMLHDLKHVCEAHFSRRDFTKSKKRLKKRAVPKLNLTLPPLRDEILLQFLQLNSQADVTPQGQFEVQAVPSALMPASSSQPSGLEKTDVTPQGQFEVQAVPCTSMPTSSSQSSSLEKSKNRFHESNSKF

Summary

Pfam
PF05485   THAP        + More
PF12017   Tnp_P_element
Interpro
IPR006612   THAP_Znf        + More
IPR021896   Transposase_37       
IPR038441   THAP_Znf_sf       
Gene 3D
PDB
2D8R     E-value=0.00954742,     Score=87

Ontologies

Topology

Length:
180
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00026
Exp number, first 60 AAs:
6e-05
Total prob of N-in:
0.24878
outside
1  -  180
 
 

Population Genetic Test Statistics

Pi
223.771566
Theta
133.75699
Tajima's D
-1.677872
CLR
39.890701
CSRT
0.0367981600919954
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号