SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02725  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA003469
Annotation
poly_A_binding_protein_[Bombyx_mori]
Full name
Polyadenylate-binding protein      
Location in the cell
Cytoplasmic   Reliability : 1.939 Nuclear   Reliability : 1.463
 

Sequence

CDS
ATGAATCCTGGTCCACCAAGTTATCCGATGGCATCTCTGTATGTTGGAGATTTACACTCTGATATAACCGAGGCCATGTTGTTTGAAAAATTTTCGACTGCTGGGCCCGTCCTATCTATACGTGTTTGTCGCGATATGATTACCCGTAGATCCTTAGGCTACGCTTATGTTAATTTTCAGCAACCTACGGATGATTTGGATGACTCCAGTGCTCTGTATGTTGCCATTAATACAAAGAAACACACTCCTAATATAATGTGCCAGGCTGAAAGAGCTTTAGACACCATGAACTTTGATATTATCAAAGGAAGACCCATTAGAATCATGTGGTCCCAACGTGATCCTTCCCTGCGCAAATCCGGAGTTGGGAATGTTTTTATAAAAAACCTTGATAAATCTATTGACAACAAGGCTTTATTTGATACATTCTCAGCGTTTGGGAATATTTTGAGTTGTAAAGTAGCTCAAGATGAGACTGGTGCTTCAAAAGGGTATGGTTTTGTTCATTTTGAAACTGAAGAAGCTGCAAATAAATCTATTGAAAAGGTAAATGGGATGTTGTTAAATGGTAAAATGGTTTATGTAGGCAGATTCATTCCACGCAAAGAGCGCGAAAAGGAACTTGGTGAGAAGGCTAAACTGTTTACCAATGTGTATGTAAAGAACTTTGGAGAAGACTTTTCTGATGAAATGTTAAAAGATATGTTTGAGAAATATGGTCGCATTACAAGTCACAAAGTTATGTACAAAGATGATGGCAATTCTAGAGGCTTTGGTTTTGTTGCTTTTGAAGACCCAGATGCTGCTGAAAGAGCTTGCATTGAATTGAATGGCAAAGAGCTAGTTGAGGGTAAGCCTCTCTATGTTGGACGTGCACAAAAGAAAGCTGAACGTCAAAAGGAGTTGAAGCGTAAGTTTGAACAACTGAAATCTGAACGCCTAACTCGTTATCAAGGTGTTAATTTGTATGTTAAGAACTTGGATGATACAATTGATGATGAACGTCTGCGCAAAGAATTTGCACCATTTGGGACTATTACGTCTGCGAAGGTAATGCTAGAAGATGGACGTAGTAAAGGCTTCGGGTTTGTCTGTTTTTCTTCTCCTGAAGAAGCTACCAAAGCAGTTACTGAGATGAATGGACGTATTGTAGGAACTAAACCATTGTATGTTGCACTAGCTCAACGCAAGGAGGACCGTAAAGCGCACTTAACATCTCAGTACATGCAGAGAATGGCTAGTATGCGCATGCAGCAAATGGGCCAAATATTCCAGCCTAGTGGTGCAAGTGGATTTTTTGTACCATCGCTCCCTCCAGCACCACGTTACTATGGACCAGCTCAAATGACTCAAATAAGACCTACAACTCCAAGGTGGAATGCACAGCCCCCTGTAAGGCCTAGCACACAAGCAGCATCTGCATATGCAAATATGCAACCCACTTACAGACCAGCACCGAGAGCTCCGGCCCAATCTACAATAAGAACATCGTTAGGTGCAAGACCCATAACTGGACAGCAAGGAGTTGCTGCTGCTGCTGCATCTATTCGTCCACCTTTAGTATCTCAAAGCAGTCGCCCAGCCAATTATAAATATACACCAAACATGCGCAACCCACCAGCTCCACAACCAGCAGTGCATATCCAAGGACAAGAACCTCTGACCTCTACTATGCTTGCAGCAGCACCACTCCAGGAACAGAAACAGATGCTTGGGGAACGACTGTTTCCACTTATTCAGAGAATGCACCCTGATTTGGCTGGGAAAATAACTGGTATGCTTTTGGAAATTGATAATTCAGAACTTCTTCATATGTTAGAACATGCAGAGTCTCTGAAAGCTAAAGTAGATGAAGCTGTTGCTGTACTGCAGGCTCATCAAGCTAAACAACAAGCAACTAAAAAAGAATAA
Protein
MNPGPPSYPMASLYVGDLHSDITEAMLFEKFSTAGPVLSIRVCRDMITRRSLGYAYVNFQQPTDDLDDSSALYVAINTKKHTPNIMCQAERALDTMNFDIIKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALFDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAANKSIEKVNGMLLNGKMVYVGRFIPRKEREKELGEKAKLFTNVYVKNFGEDFSDEMLKDMFEKYGRITSHKVMYKDDGNSRGFGFVAFEDPDAAERACIELNGKELVEGKPLYVGRAQKKAERQKELKRKFEQLKSERLTRYQGVNLYVKNLDDTIDDERLRKEFAPFGTITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEDRKAHLTSQYMQRMASMRMQQMGQIFQPSGASGFFVPSLPPAPRYYGPAQMTQIRPTTPRWNAQPPVRPSTQAASAYANMQPTYRPAPRAPAQSTIRTSLGARPITGQQGVAAAAASIRPPLVSQSSRPANYKYTPNMRNPPAPQPAVHIQGQEPLTSTMLAAAPLQEQKQMLGERLFPLIQRMHPDLAGKITGMLLEIDNSELLHMLEHAESLKAKVDEAVAVLQAHQAKQQATKKE

Summary

Description
Binds the poly(A) tail of mRNA.
Similarity
Belongs to the polyadenylate-binding protein type-1 family.
EMBL
DQ646407    ABH10797.1    KZ150495    PZC70675.1    NWSH01000990    PCG73204.1    + More
ODYU01006578    SOQ48542.1    AK402317    BAM18939.1    KQ460207    KPJ16729.1    AK401104    BAM17726.1    KQ459597    KPI94844.1    GAIX01013920    JAA78640.1    MG846895    AXY94747.1    AGBW02008321    OWR53699.1    JTDY01007562    KOB65113.1    NEVH01013256    PNF29191.1    NEVH01013563    PNF28560.1    KK852549    KDR21568.1    PCG73205.1    KZ288425    PBC25923.1    JR046784    AEY60249.1    KQ976731    KYM76242.1    ADTU01006976    KQ434786    KZC05162.1    AAZX01006389    AAZX01006683    KQ977858    KYM99295.1    KQ980724    KYN14060.1    NNAY01000718    OXU26809.1    KQ981523    KYN40394.1    GL887707    EGI70256.1    KK107790    QOIP01000010    EZA47761.1    RLU18011.1    KQ982297    KYQ58171.1    GEZM01054088    JAV73853.1    KQ971307    KYB29724.1    GEDC01029963    JAS07335.1    GL445067    EFN60208.1    GBHO01020638    GBRD01010657    GDHC01004198    JAG22966.1    JAG55167.1    JAQ14431.1    GBHO01020637    GBRD01001909    GDHC01000230    JAG22967.1    JAG63912.1    JAQ18399.1    KYM76241.1    KYN40393.1    EGI70257.1    KYM99294.1    EFA11220.1    GALX01003056    JAB65410.1    DS235886    EEB20472.1    APGK01047223    BT127180    KB741077    KB631792    AEE62142.1    ENN74236.1    ERL86135.1    GEZM01010785    JAV93835.1    GDJX01027204    JAT40732.1    GANO01000888    JAB58983.1    GFDF01008284    JAV05800.1    GFDF01008283    JAV05801.1    UFQS01000128    UFQT01000128    SSX00191.1    SSX20571.1    AJWK01017220    AJWK01017221    GFDF01008282    JAV05802.1    GAMD01003167    JAA98423.1    GGFK01000203    MBW33524.1    GGFM01000161    MBW20912.1    GGFJ01003120    MBW52261.1    ABLF02016904    DQ440228    CH477655    ABF18261.1    EAT37709.1    GGFJ01003121    MBW52262.1    ADMH02001295    ETN63107.1    GFXV01004519    MBW16324.1    BABH01008005    BABH01008006    GAPW01000522    GAPW01000521    JAC13076.1    AXCN02002137    GECU01021667    JAS86039.1    GFDL01009817    JAV25228.1    DS231998    EDS31071.1    ATLV01024277    KE525351    KFB51177.1    GFAH01000442    JAV47947.1    CVRI01000011    CRK89202.1    GDRN01041197    JAI67105.1    AAAB01008816    MH538277    AYA22653.1    APCN01001462    KK113500    KFM60343.1    GFWZ01000291    MBW20281.1    IAAA01006564    LAA01816.1    GDIQ01002172    JAN92565.1    EAA05186.3    GDIQ01028451    JAN66286.1    GDAI01001380    JAI16223.1    GDIP01135183    JAL68531.1    GDIP01043332    JAM60383.1    KYN14058.1    KQ983066    KYQ47782.1   
Pfam
PF00658   PABP        + More
PF00076   RRM_1
Interpro
IPR000504   RRM_dom        + More
IPR002004   PABP_HYD       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR035979   RBD_domain_sf       
IPR036053   PABP-dom       
IPR003954   RRM_dom_euk       
IPR006515   PABP_1234       
IPR000253   FHA_dom       
SUPFAM
SSF63570   SSF63570        + More
SSF54928   SSF54928       
Gene 3D
PDB
6R5K     E-value=1.11838e-112,     Score=1042

Ontologies

Topology

Subcellular location
Cytoplasm  
Length:
636
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01167
Exp number, first 60 AAs:
0.00043
Total prob of N-in:
0.00010
outside
1  -  636
 
 

Population Genetic Test Statistics

Pi
24.569549
Theta
240.645378
Tajima's D
-1.021964
CLR
1022.538242
CSRT
0.136493175341233
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 NPPAPQPAVHIQGQEPLTSTMLAAAPLQEQK 100.00 2e-14
28556443 NLDDTIDDER 100.00 2e-14
28556443 NFGEDFSDEMLK 100.00 2e-14
26280517 SIYDDPIAAAER 100.00 1e-05
27102218 MVYVGR 100.00 1e-05
26822097 EIVEGKPIYVGR 100.00 1e-04
26280517 GYFFQPTVFTDVTDEMYIAK 100.00 1e-04
25044914 GYGFGGGAGCISMDTGDHIK 100.00 1e-04
27102218 SGVGNVFIK 100.00 1e-04
28467696 GYGFVEYTRPDDAVK 100.00 1e-04
28556443 GFGFVCFSSPEEATK 100.00 1e-04
28556443 ELVEGKPLYVGR 100.00 1e-04
26822097 GFGFVAFEDPDAAER 100.00 1e-04
26280517 FITIWENNR 100.00 1e-04
25044914 GFGFVAFEDPDAAER 100.00 1e-04
27102218 VMIEDGR 100.00 1e-04
28467696 GFGFVAFEDPDAAER 100.00 1e-04
28556443 GFGFVAFEDPDAAER 100.00 1e-04
28556443 GFGFVAFEDPDAAER 100.00 1e-04
26822097 IVGTKPIYVAIAQR 100.00 5e-04
26280517 GFDPGQDTYEHPPADGSK 100.00 5e-04
25044914 GFGFISFEDEISVER 100.00 5e-04
27102218 AIDTMNFDIIK 100.00 5e-04
28467696 GFGFITYSK 100.00 5e-04
28556443 GFGFVAFEDPDAAER 100.00 5e-04
28556443 GFGFVAFEDPDAAER 100.00 5e-04
28556443 ELVEGKPLYVGR 100.00 5e-04
28556443 ALDTMNFDIIK 100.00 5e-04
28556443 SGVGNVFIK 100.00 0.001
28556443 NPPAPQPAVHIQGQEPLTSTMLAAAPLQEQK 100.00 0.001
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号