SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02665
Annotation
PREDICTED:_uncharacterized_protein_LOC106137189_isoform_X1_[Amyelois_transitella]
Location in the cell
Mitochondrial   Reliability : 1.014 PlasmaMembrane   Reliability : 1.53
 

Sequence

CDS
ATGCACCATCACACACTTCACATCGATGCTGGCGCTGGTGCCATTTCAGGAAATAATGCCAGCTCGGTGGCTCTTACCGTTTCTACAACTTCGACAGTCTTGCTCGGAACCGCAATTATACACGTCGCAGATTGTTGGGGCATTTATCAACCCGTACGTGCTATAATTGACAGTGGTGCCATGACGGGCTACATAACTCATGACTGTGCATTAAGGTTAGGACTAGGGCGAAGAAAGTGTGATTTCGATTCCATTGGTCTAGGTGCCAAGCCTATTGCAGATCTGGGGCTAACTACCTGTACTGTAAAACCGCGTCAGTGCAACAGCCCCATATTAACTACTGATGCAGTCATAGTTACGAAAATAGCCGGAAATCTACCAACTATGTCTATCTCAGATGATGTGATCCGTAAATTTCAAAATCTTTCACTTGCTGATCCAACTTTTGGTACATCGGGTCCCATCGACATGTTATTGGCCGGTGATCTATTTCCTCAAATTTATGATGGAGAAAAGATCATGCCACAAGATAAGAACATGCCAGTGGCTTTGCATTCCATTTTCGGCTACGTCATTGCAGGTCAAGTATCGATTTCGGGTCATAGAACTGTAGACACGGAAAATCATAATATCAAAAGCAATAATACAAAATCATTTGTTGCCCTTTCTATTAACGTGGAGCATGAAACGCAGTCTTTCTCGGAGACAGAAAGCATTTGCTTCAACGAACCACAGCATCCAGATAATATATCAGTAGGGACATTGTCTGATCGCGATCATAACCGTGATAAGAAAAGTAGATGTTTCGTAAACTACCCTTTGCAACCTTTTTATAAACTTGGTGTTTTATCTGGAGCAGAAGAACGTAAATATATTGATATAGAAAAGAAGTTGGAACGCGATCTGAATTTAAAATTCATTCATCATGCAAAACAATACATGAGTGGTTTAACGGCCTCCATCGGCTTAATGACTTCCAGTCAGAGGGTCCAGTTAAACCTATAA
Protein
MHHHTLHIDAGAGAISGNNASSVALTVSTTSTVLLGTAIIHVADCWGIYQPVRAIIDSGAMTGYITHDCALRLGLGRRKCDFDSIGLGAKPIADLGLTTCTVKPRQCNSPILTTDAVIVTKIAGNLPTMSISDDVIRKFQNLSLADPTFGTSGPIDMLLAGDLFPQIYDGEKIMPQDKNMPVALHSIFGYVIAGQVSISGHRTVDTENHNIKSNNTKSFVALSINVEHETQSFSETESICFNEPQHPDNISVGTLSDRDHNRDKKSRCFVNYPLQPFYKLGVLSGAEERKYIDIEKKLERDLNLKFIHHAKQYMSGLTASIGLMTSSQRVQLNL

Summary

EMBL
GBHO01006408    JAG37196.1    GBRD01007977    JAG57844.1    GGMR01002187    MBY14806.1    + More
ABLF02006784    ABLF02043036    GGMR01009854    MBY22473.1    ABLF02004278    ABLF02004280    ABLF02065929    GGMS01012504    MBY81707.1    GGMR01003897    MBY16516.1    ABLF02067195    GGMR01008932    GGMR01010920    MBY21551.1    MBY23539.1    ABLF02034704    ABLF02034708    ABLF02034709    ABLF02044644    ABLF02055319    GGMR01010198    MBY22817.1    GGMR01019355    MBY31974.1    GGMS01011369    MBY80572.1    GGMS01006636    MBY75839.1    ABLF02021785    GGMS01014951    MBY84154.1    ABLF02026240    ABLF02055027    GBHO01007689    JAG35915.1    ABLF02025193    ABLF02040487    ABLF02059921    ABLF02067163    ABLF02003331    ABLF02003332    GGMR01005823    MBY18442.1    GALX01004947    JAB63519.1    ABLF02008553    ABLF02008554    GBHO01028830    JAG14774.1    GGMS01012379    MBY81582.1    GDHC01008459    JAQ10170.1    GGMR01003717    MBY16336.1    ABLF02042081    GBHO01024761    JAG18843.1    GGMR01014306    MBY26925.1    GBHO01007061    JAG36543.1    GDHC01016727    JAQ01902.1    GGMR01004029    MBY16648.1    GGMR01018294    MBY30913.1    GBHO01008418    GBHO01008416    JAG35186.1    JAG35188.1    GBHO01012499    GBHO01012498    GBHO01012497    GBHO01007479    GBHO01007451    GBHO01007450    JAG31105.1    JAG31106.1    JAG31107.1    JAG36125.1    JAG36153.1    JAG36154.1    GALX01002411    JAB66055.1    GBHO01017458    JAG26146.1    GBHO01031928    GBHO01031926    JAG11676.1    JAG11678.1    GGMR01014351    MBY26970.1    GBHO01028371    GBHO01028370    JAG15233.1    JAG15234.1    GDHC01014268    JAQ04361.1    GBHO01000061    JAG43543.1    GBHO01000060    JAG43544.1    GBHO01037783    JAG05821.1    GGMR01017784    MBY30403.1    GBHO01037781    JAG05823.1    GDHC01016272    JAQ02357.1    GGMR01013824    MBY26443.1    GGMR01006575    MBY19194.1    GECZ01008071    JAS61698.1    GBHO01000059    JAG43545.1    GGMR01002024    MBY14643.1    GBHO01013680    JAG29924.1    ABLF02003339    ABLF02058001    GBBI01004463    JAC14249.1    GBBI01004318    JAC14394.1   
Pfam
PF05585   DUF1758        + More
PF17921   Integrase_H2C2
PF05380   Peptidase_A17
PF00665   rve
PF03564   DUF1759
PF18701   DUF5641
PF09337   zf-H2C2
PF10551   MULE
PF00078   RVT_1
Interpro
IPR001584   Integrase_cat-core        + More
IPR008042   Retrotrans_Pao       
IPR012337   RNaseH-like_sf       
IPR008737   Peptidase_asp_put       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR005312   DUF1759       
IPR040676   DUF5641       
IPR015416   Znf_H2C2_histone_UAS-bd       
IPR021109   Peptidase_aspartic_dom_sf       
IPR036875   Znf_CCHC_sf       
IPR001969   Aspartic_peptidase_AS       
IPR001878   Znf_CCHC       
IPR007527   Znf_SWIM       
IPR018289   MULE_transposase_dom       
IPR000477   RT_dom       
IPR001995   Peptidase_A2_cat       
IPR017907   Znf_RING_CS       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
SSF50630   SSF50630       
Gene 3D

Ontologies

Topology

Length:
334
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
7.92118
Exp number, first 60 AAs:
7.31227
Total prob of N-in:
0.28974
outside
1  -  334
 
 

Population Genetic Test Statistics

Pi
218.874587
Theta
186.407352
Tajima's D
0.479529
CLR
111.203613
CSRT
0.504574771261437
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号