SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02657
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.202 Nuclear   Reliability : 1.4
 

Sequence

CDS
ATGGTCAGGAACGACAGGCTCTCTGCTCGTGGTGGTGGTACCGTCATTTACTATAGAAGAGCCCTGCATTGCGTCCCACTCGATCCTCCCGCGCTCGCTAATATCGAAGCATCAGTGTGCCGAATCTCACTGACGGGACACGCGCCGATCGTTATCGCGTCCGTTTATCTTCCACCGGATAAGATCGTTCTAAGCAGTGATATCGAGGCGCTGCTCGGCATGGGGAGCTCTGTCATTCTGGCGGGCGACCTAAATTGTAAACACATTAGGTGGAACTCACACACCACAACCCCGAATGGCAGGCGGCTTGACGCGTTAGTCGATAATCTCGCCTTCGATATCGTCGCTCCGCTAATCCCGACTCACTACCCGCTAAATATCGCGCATCGCCCGGATATACTCGACATAGCGTTATTAAAAAACGTAACTCTGCGCTTACACTCGATCGAAGTAGTTTCAGAGTTAGATTCAGACTACCGTCCCGTCGTTATGAAGCTCGGTCGCGCTCCCGATTCCGTTCCCGTCACGAGGACTGTGGTGGATTGGCACACGCTGGGCATCAGCCTGGCTGAATCTGATCCACCATCGCTACCGTTTAGCCCGGACTCTACCCCGTCTCCTCAGGATACCGCTGAAGCCATAGACATCTTAACGTCACACATCACCTCGACATTAGATAGGTCATCGAAACAAGTTGTAGCGGAGGACTTCCTTCACCGCTTCAAATTGTCCGACGATATTAGGGAACTCCTTAGAGCTAAGAACGCCTCGATACGCGCCTACGACAGGTATCCTACCGCGGAAAATCGTATTCGAATGCGTGCCCTACAACGCGACGTAAAGTCTCGCATCGCCGAAGTCCGAGATGCCAGATGGTCTGATTTCTTAGAAGGACTCGCGCCCTCCCAAAGGTCTTACTACCGCTTAGCTCGTACTCTCAAATCGGATACGGTAGTAACTATGCCCCCCTCGTAG
Protein
MVRNDRLSARGGGTVIYYRRALHCVPLDPPALANIEASVCRISLTGHAPIVIASVYLPPDKIVLSSDIEALLGMGSSVILAGDLNCKHIRWNSHTTTPNGRRLDALVDNLAFDIVAPLIPTHYPLNIAHRPDILDIALLKNVTLRLHSIEVVSELDSDYRPVVMKLGRAPDSVPVTRTVVDWHTLGISLAESDPPSLPFSPDSTPSPQDTAEAIDILTSHITSTLDRSSKQVVAEDFLHRFKLSDDIRELLRAKNASIRAYDRYPTAENRIRMRALQRDVKSRIAEVRDARWSDFLEGLAPSQRSYYRLARTLKSDTVVTMPPS

Summary

EMBL
U07847    AAA17752.1    AB055391    BAB21761.1    AB018558    BAA76304.1    + More
KQ459265    KPJ02064.1    AF081103    AAC72921.1    GEZM01008457    JAV94772.1    GEBQ01004157    JAT35820.1    GGMS01012398    MBY81601.1    GEBQ01003077    JAT36900.1    ABLF02022418    KB632143    ERL89075.1    KQ973342    KXZ75569.1    GBBI01004395    JAC14317.1    ABLF02012584    ABLF02013765    ABLF02024884    ABLF02008153    ABLF02008462    ABLF02008464    ABLF02036316    ABLF02036319    ABLF02048663    ABLF02066977    ABLF02010814    ABLF02010815    ABLF02037860    ABLF02037869    KK115285    KFM64681.1    GGMR01012189    MBY24808.1    GGMR01004661    MBY17280.1    GGMS01006359    MBY75562.1    ABLF02003241    ABLF02003242    ABLF02025904    GEZM01021868    JAV88847.1    GALX01005299    JAB63167.1    GGMR01018716    MBY31335.1    GEZM01099921    GEZM01099920    GEZM01099918    GEZM01099906    JAV53125.1    ABLF02025082    ABLF02039175    ABLF02041809    JTDY01005246    KOB67202.1    GGMS01010725    MBY79928.1    ABLF02014934    ABLF02014939    ABLF02017810    KK118005    KFM71947.1    ACPB03027378    GBGD01000415    JAC88474.1    GGMR01016297    MBY28916.1    ABLF02042385    ABLF02065839    KK113281    KFM59799.1    ABLF02009591    ABLF02009592    ABLF02009594    ABLF02066703    JTDY01002082    KOB72150.1    KK119692    KFM76444.1    GFTR01008279    JAW08147.1    LBMM01018021    KMQ83899.1    GFTR01008262    JAW08164.1    JTDY01011738    KOB53653.1    NEVH01023280    PNF18085.1    ABLF02037715    ACPB03022356    ABLF02001804    ABLF02035179    ABLF02062794    ABLF02023911    ABLF02015631    ABLF02021986    ABLF02021987    ABLF02021991    GGMR01001088    MBY13707.1    MCIT02004487    PHT96476.1    GGMR01016905    MBY29524.1    ACPB03000870    GGFK01009846    MBW43167.1    GGFK01009732    MBW43053.1    KQ971729    KYB24751.1    ABLF02042518    ABLF02057746    GGMS01006655    MBY75858.1    GGMS01001094    MBY70297.1    GGMR01000226    MBY12845.1    LBMM01014024    KMQ85369.1    ABLF02007779    ABLF02007782    ABLF02050375    KK119261    KFM75202.1    GGFL01005012    MBW69190.1    ABLF02043963    GGMS01000479    MBY69682.1    GGMR01012443    MBY25062.1    GFTR01008261    JAW08165.1    GFTR01008260    JAW08166.1    GEDC01029594    JAS07704.1    GBBI01004571    JAC14141.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF07530   PRE_C2HC
PF14291   DUF4371
PF05699   Dimer_Tnp_hAT
PF07727   RVT_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR006579   Pre_C2HC_dom       
IPR025398   DUF4371       
IPR012337   RNaseH-like_sf       
IPR008906   HATC_C_dom       
IPR006580   Znf_TTF       
IPR013103   RVT_2       
SUPFAM
SSF56219   SSF56219        + More
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
324
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.09677
Exp number, first 60 AAs:
0.0539
Total prob of N-in:
0.07763
outside
1  -  324
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
321.518714
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号