SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02614
Pre Gene Modal
BGIBMGA002632
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Full name
Queuine tRNA-ribosyltransferase accessory subunit 2      
Alternative Name
Queuine tRNA-ribosyltransferase domain-containing protein 1
Location in the cell
Mitochondrial   Reliability : 2.06 Nuclear   Reliability : 1.829
 

Sequence

CDS
ATGCAAGAATACAACATTCACATTCTTGGATTGAGTGAGACGAGATGGAACGGTTTTGGAGAAACGCAATGTGATTTTGGATACTCGTTATTGTACAGTGGTAAGGAAGAGGATGCGACCCGAGAGTATGGCGTGGGTTTGCTGCTAAGTCGCAGCGCTAAAAGTAGCTTACTCTCTTGGAAGCCAGTCTCGGAACGAATAATATGCGCCAGATACGGTCACGACTCGACACGAGTACGGAAGGTGACAGTGATACAATGCTACGCTCCCACTAACTCTGCTTCGACCGATGTAAAGTCACAATTCTACGAACAGCTGGGGCATACACTCAAAGGCATCAAGAAACAAGATATCGTGATTCTCATGGGCGACATAAATGCGAAGATGGGAAATGACAATGTAGACCGCGAATATTACATGGGACAATATGGGGCAACCGGAACTATTAACGAAAACGGAGAACTTTTCGGTGATCTATGTTCCACACATGGTCTAGTTATTGGAGGTACCCTATTTAAGCATAAGGAATGTCATAAAGTTACTTGGATATCACCGGACGGAAAGACAAAGAACCAAATCGATCACGTAGCTATCAGTAAGACATGGCGCTCTTCTCTTCTTGATGTGCGAAATAAGCGCGGCGCAGACATTGACAGTGATCACCATCTGGTGGTAGCAGAAGTTCGTCTTAAAATAGCAGTTCCCCACAGAAAGCCAGATAAAGCAGCTAGAAAATTTTATATCCGAAAACTGGAAGATAGCAATTGCCGAGAGAAGTTCAGCTTATCTCTCAAAAATAGTTTCGAGCTGCTTAAGGAAATAGAGGATGAGCAGATGGACGAGACGTGGGACCGCATACGTGGTGCTATAATAAAGCTGCTAAGGAAGTATTGGGGTATACCAATACAAAGCAAGAACCTTGGATATGCTATGTTGCGTCGGGAATACTCATCCACGCGATTAGTAATTAGAAAGCTGGCTAGGAGAGATCAGCGAAATGCAATCGATGAGCTAGCAGACCGAGCAAAATTGGCAGCCAAGAGGCAAGATATGAAAGAGCTTTACGATGTCACCAAGCGGATAATAAACAAAAAACATCATCCACGGAAAAAACCACTGAAAGACTGCTCGGGTCAGCTACTATGTACCACGGAAGAGCAGCTCGTGCGCTGGACGGAGCACTTTACTAAGTTGCTGTCCAAATGTCAGTCCCAACCCACAGACGGAATATCAGTACCCGACTTGCCTTTGGATATACCTATTGCACCGCCCACCTTTAATGAAATAGTAAAGGCAATTAAACAGCTGAAACCAGGTAAGGCCCCCGGTATTGACAATATCAATGCCGAAATGCTGAAGGCTGATGCACCGAGATCTGCAAGCTTGCTATATCCGCTCATCGTAAGGATTTGGGAGACTGAGCAAATACCGTCTCAATGGAAGCAGGGACTACTCGTGAAAGTTCCGAAGAAGGGCGATTTGTCTTCTTGTGACAACTGGAGAGGCATTACACTTCTTCCTTGCGCAGCAAAGGTCTTGGCTAGATTACTTCTAAACCGGATGTCCAAAAAGATCACTGGAACTCTTCGGGAGGAGCAAGCAGGTTTCTTACCGGGCCGATCATGCACAGACCATACAAACACTCTTCGCATCCTCATAGAACAAAGTGTCGAATGGCAGACTGAAATGATTCTTACGTTTGTAGACTTTGAGAAAGCGTTTGACACTGTACAGTGGAGCAAAATGTGGACCTGCTTAAAACAAAGAGGTATACCAAATAAAATCATTGGTATAATCCAGGCCTTATACAGAGAACAGCTACTTTGA
Protein
MQEYNIHILGLSETRWNGFGETQCDFGYSLLYSGKEEDATREYGVGLLLSRSAKSSLLSWKPVSERIICARYGHDSTRVRKVTVIQCYAPTNSASTDVKSQFYEQLGHTLKGIKKQDIVILMGDINAKMGNDNVDREYYMGQYGATGTINENGELFGDLCSTHGLVIGGTLFKHKECHKVTWISPDGKTKNQIDHVAISKTWRSSLLDVRNKRGADIDSDHHLVVAEVRLKIAVPHRKPDKAARKFYIRKLEDSNCREKFSLSLKNSFELLKEIEDEQMDETWDRIRGAIIKLLRKYWGIPIQSKNLGYAMLRREYSSTRLVIRKLARRDQRNAIDELADRAKLAAKRQDMKELYDVTKRIINKKHHPRKKPLKDCSGQLLCTTEEQLVRWTEHFTKLLSKCQSQPTDGISVPDLPLDIPIAPPTFNEIVKAIKQLKPGKAPGIDNINAEMLKADAPRSASLLYPLIVRIWETEQIPSQWKQGLLVKVPKKGDLSSCDNWRGITLLPCAAKVLARLLLNRMSKKITGTLREEQAGFLPGRSCTDHTNTLRILIEQSVEWQTEMILTFVDFEKAFDTVQWSKMWTCLKQRGIPNKIIGIIQALYREQLL

Summary

Description
Non-catalytic subunit of the queuine tRNA-ribosyltransferase (TGT) that catalyzes the base-exchange of a guanine (G) residue with queuine (Q) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
Cofactor
Zn(2+)
Subunit
Heterodimer of a catalytic subunit and an accessory subunit.
Similarity
Belongs to the queuine tRNA-ribosyltransferase family. QTRT2 subfamily.
EMBL
FJ265558    ADI61826.1    BABH01014180    BABH01014181    BABH01014182    BABH01014183    + More
GDHC01000226    JAQ18403.1    AJWK01034673    UFQT01001780    SSX31783.1    BN000794    CAJ00236.1    LSMT01001244    PFX12648.1    LSMT01000478    PFX17357.1    FN356221    CAX83710.1    UZAI01017328    VDP23394.1    PZQS01000003    PVD33720.1    AAGJ04045270    UZAI01022169    VDP57417.1    ADMH02001629    ETN61698.1    AFYH01088828    UZAI01016872    VDP17428.1    UZAI01002797    VDO74729.1    HACG01049283    CEK96148.1    UFQS01000142    UFQT01000142    SSX00428.1    SSX20808.1    MRZV01000990    PIK41764.1    UZAI01017464    VDP25179.1    UZAI01017973    VDP31675.1    UZAK01036860    VDP56899.1    PZQS01000012    PVD20578.1    UZAI01019871    VDP48262.1    UZAI01000669    VDO55444.1    UZAI01017784    VDP29476.1    GGMR01020071    MBY32690.1    GBBI01004263    JAC14449.1    KZ150025    PZC74827.1    UZAI01000113    VDO48731.1    UZAI01022444    VDP57962.1    GDHC01021627    JAP97001.1    JARK01001341    EYC29874.1    PYGN01003402    PSN29545.1    GBBI01004261    JAC14451.1    HACG01048259    CEK95124.1    GAPW01000107    JAC13491.1    UZAI01017324    VDP23363.1    UZAI01018571    VDP38269.1    UZAI01018190    VDP34363.1    PDHN01000949    PGH37547.1    GBRD01011073    JAG54751.1    UZAI01016773    VDP15570.1    ABLF02018097    ABLF02043469    ABLF02056908    PYGN01000020    PSN57453.1    PYGN01000203    PSN51319.1    UZAK01032956    VDP33068.1    HE799691    CCH14900.1    PYGN01000324    PSN48495.1    GGMS01009011    MBY78214.1    ABLF02035454    ABLF02035459    ABLF02035461    ABLF02042121    FJ265559    ADI61827.1    GAKP01012607    JAC46345.1    PYGN01001004    PSN38555.1    UZAI01019418    VDP45194.1    GBBI01004198    JAC14514.1    FJ265555    ADI61823.1    GECL01001585    JAP04539.1    FJ265546    ADI61814.1    GEZM01098732    JAV53782.1    PYGN01000070    PSN55417.1    GBBM01003639    JAC31779.1    ABLF02042851    UZAI01019647    VDP46800.1    GBBI01004262    JAC14450.1    UZAI01017731    VDP28843.1    UZAI01000112    VDO48722.1    AAGJ04063063    AAGJ04063064    AAGJ04063065    JARK01001422    EYC04705.1    GBBI01004199    JAC14513.1    AF412214    AAM93546.1    PYGN01000219    PSN50892.1    GAPW01000120    JAC13478.1    AY027869    AAK14815.1    GBGD01000583    JAC88306.1    AJVK01001578    GBGD01000559    JAC88330.1    KU311054    ALX81665.1    PYGN01000129    PSN53384.1    GALA01001775    JAA93077.1    FJ265548    ADI61816.1    UZAK01038324    VDP60854.1    UZAI01001301    VDO60450.1    GBGD01000331    JAC88558.1    UZAG01001147    VDO10529.1    ABLF02039015   
Pfam
PF00078   RVT_1        + More
PF01702   TGT
PF14529   Exo_endo_phos_2
PF03372   Exo_endo_phos
PF00069   Pkinase
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027124   Swc5/CFDP2       
IPR036511   TGT-like_sf       
IPR028592   QTRTD1       
IPR002616   tRNA_ribo_trans-like       
IPR005135   Endo/exonuclease/phosphatase       
IPR000719   Prot_kinase_dom       
IPR017441   Protein_kinase_ATP_BS       
IPR011009   Kinase-like_dom_sf       
IPR000637   HMGI/Y_DNA-bd_CS       
SUPFAM
SSF56219   SSF56219        + More
SSF51713   SSF51713       
SSF56112   SSF56112       
Gene 3D

Ontologies

Topology

Subcellular location
Cytoplasm  
Length:
608
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.04167
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00045
outside
1  -  608
 
 

Population Genetic Test Statistics

Pi
576.012105
Theta
239.798045
Tajima's D
4.416139
CLR
0.596177
CSRT
0.999850007499625
Interpretation
Possibly Balancing Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号