SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02561
Pre Gene Modal
BGIBMGA002681
Annotation
hypothetical_protein_KGM_01714_[Danaus_plexippus]
Location in the cell
PlasmaMembrane   Reliability : 4.5
 

Sequence

CDS
ATGTTGCTATACCCTTTGTGTGTGGCAGGCGCCATATACTCCCTTGTCTATGAACCGCATAAAAGTTGGTACTCCTGGGCTTTACACAGCATAGTGAATGGAGTGTATGCTTTCGGTTTTCTATTCATGTTGCCGCAACTGTTCGTGAACTATCGGCTTCGTTCTGTGGCAGCGCTGCCGTGGCGCGCCTTCATGTACAAAGCCTTCAACACGTTCATAGACGATGTGTTCGCGTTTATAATAACCATGCCGACCGCGCATCGCATGGCCTGCTTCAGGGACGATCTAGTCTTCCTTGTTTATCTGTATCAGAGATGGTTGTATCCTGTAGACAAAACTCGTGTAGATACAGGAGCGAGTATGGATGCAAGTTCAGAAGAAGTTGAAACGCCCAAAAAGAAAACAGAATAG
Protein
MLLYPLCVAGAIYSLVYEPHKSWYSWALHSIVNGVYAFGFLFMLPQLFVNYRLRSVAALPWRAFMYKAFNTFIDDVFAFIITMPTAHRMACFRDDLVFLVYLYQRWLYPVDKTRVDTGASMDASSEEVETPKKKTE

Summary

EMBL
BABH01014319    BABH01014320    BABH01014321    BABH01014322    NWSH01000735    PCG74507.1    + More
ODYU01012823    SOQ59317.1    AGBW02008106    OWR54160.1    GAIX01005789    JAA86771.1    GDQN01005114    JAT85940.1    GDQN01008889    GDQN01008413    GDQN01005545    GDQN01004461    GDQN01002901    JAT82165.1    JAT82641.1    JAT85509.1    JAT86593.1    JAT88153.1    KQ461103    KPJ09367.1    KQ459589    KPI97578.1    PYGN01000337    PSN48282.1    GAMC01002362    JAC04194.1    CP012528    ALC48767.1    GDHF01008876    JAI43438.1    UFQS01000320    UFQT01000320    SSX02839.1    SSX23207.1    GDHF01004662    JAI47652.1    GEDC01018156    JAS19142.1    GEDC01011458    GEDC01000330    JAS25840.1    JAS36968.1    CH477432    EAT41010.1    GAKP01005728    JAC53224.1    GECZ01014715    JAS55054.1    GECZ01002375    JAS67394.1    GAMC01002363    JAC04193.1    CH963925    EDW78430.1    ATLV01019742    KE525279    KFB44595.1    GAPW01000855    JAC12743.1    CH916371    EDV92310.1    GANO01001344    JAB58527.1    CH933812    EDW05977.1    GBXI01017517    JAC96774.1    CH480836    EDW48984.1    CM000366    EDX17794.1    AE014298    AY051932    AAF48234.1    AAK93356.1    AJWK01016004    CH940653    EDW62332.1    LNIX01000021    OXA43538.1    CH902622    EDV34442.1    CM000162    EDX01538.1    AJWK01010200    KQ971319    EEZ99580.1    OUUW01000011    SPP86343.1    GEMB01000786    JAS02352.1    CH954180    EDV47232.1    CH379064    EAL32144.2    GBXM01010947    JAH97630.1    GDIQ01055251    JAN39486.1    JRES01000557    KNC30254.1    GEBQ01011277    JAT28700.1    ACPB03000797    ACPB03000798    ACPB03000799    ACPB03000800    KQ982790    KYQ50676.1    NEVH01016973    PNF24787.1    GEZM01007084    JAV95412.1    ADMH02001137    ETN63976.1    GL451420    EFN79326.1    CVRI01000063    CRL04485.1    APCN01000878    KK107020    QOIP01000006    EZA62575.1    RLU21134.1    NNAY01000789    OXU26506.1    DS235006    EEB10382.1    KB203854    ESO82684.1    AGBW02008165    OWR54080.1    LJIJ01000617    ODM95809.1    PNF24786.1    GGFJ01003948    MBW53089.1    GGFJ01003947    MBW53088.1    AXCM01003927    KQ981993    KYN31124.1    AXCN02001524    AAZX01013039    GFDF01011141    JAV02943.1    GDIQ01130832    GDIQ01031576    JAN63161.1    AAAB01008987    EAA01824.5    GGMS01000797    MBY70000.1    GBBK01004602    JAC19880.1    ADTU01027573    ADTU01027574    HACG01020992    CEK67857.1    GBHO01021577    GDHC01014325    GDHC01001097    JAG22027.1    JAQ04304.1    JAQ17532.1    GBRD01018132    JAG47695.1    GECL01003492    JAP02632.1    GG666667    EEN44748.1   
Pfam
PF05602   CLPTM1
Interpro
IPR030434   CLPTM1L        + More
IPR008429   CLPTM1       

Ontologies

Topology

Length:
136
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
37.20123
Exp number, first 60 AAs:
24.20613
Total prob of N-in:
0.15771
POSSIBLE N-term signal
sequence
outside
1  -  21
TMhelix
22  -  44
inside
45  -  136
 
 

Population Genetic Test Statistics

Pi
197.511487
Theta
172.300467
Tajima's D
0.293928
CLR
0.231775
CSRT
0.459277036148193
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号