SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02488
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.233
 

Sequence

CDS
ATGACCATTAACGCTGGCGTTCCACAAGGTTCGGTGCTCTCCCCCACGCTTTTCATCCTGTATATCAATGACATGCTGTCTATTGATGGCATGCATTGCTATGCGGATGACAGCACGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGGAGCTTGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCAAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGTTAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATTGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGGCTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCGGTCTCACGGATCGTTTGGAACCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGGTCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MTINAGVPQGSVLSPTLFILYINDMLSIDGMHCYADDSTGDARYIGHQSLSRSLVQERRSKLVSEVENSLGRVSKWGELNLVQFNPLKTQVCAFTAKKDPFVMAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPGLTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR

Summary

EMBL
AY359886    AAQ57129.1    AB126052    BAD86652.1    ODYU01002162    SOQ39302.1    + More
GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    LWDP01000391    ORD92879.1    GFAC01000919    JAT98269.1    GEFM01002394    JAP73402.1    GEFM01002324    JAP73472.1    GEGO01001118    JAR94286.1    GEGO01004433    JAR90971.1    GDRN01111277    JAI56804.1    GFAA01002657    JAU00778.1    GFAA01002479    JAU00956.1    GFAA01002514    JAU00921.1    GFAC01005646    JAT93542.1    GEGO01003312    JAR92092.1    GEGO01004630    JAR90774.1    GBIH01002577    JAC92133.1    GEFM01006417    JAP69379.1    GEFM01005882    JAP69914.1    LSMT01000297    PFX20951.1    GEFM01002419    JAP73377.1    GEFM01006421    JAP69375.1    GDRN01111334    JAI56796.1    NSIT01000412    PJE77717.1    GFAC01005665    JAT93523.1    MRZV01000639    PIK46517.1    FLMD02000280    SCV66640.1    GEGO01002473    JAR92931.1    FLMD02000154    SCV66010.1    GEGO01003111    JAR92293.1    GEGO01003794    JAR91610.1    KZ505886    PKU43598.1    GEGO01007438    JAR87966.1    GEGO01004295    JAR91109.1    GFAC01000861    JAT98327.1    GADI01001229    JAA72579.1    GFAC01005670    JAT93518.1    NSIT01000239    PJE78188.1    GFAA01000066    JAU03369.1    GFAA01002385    JAU01050.1    GEGO01007187    JAR88217.1    NSIT01000218    PJE78268.1    GFAA01003161    JAU00274.1    AAGJ04096877    GEGO01003518    JAR91886.1    GEGO01003427    JAR91977.1    GFAA01002726    JAU00709.1    PSZC01000087    PPJ25136.1    NSIT01000271    PJE78081.1    GEGO01002794    JAR92610.1    NSIT01000538    PJE77518.1    NSIT01000164    PJE78524.1    AGCU01164164    NSIT01000477    PJE77602.1    AGCU01081420    NEDP02004020    OWF47171.1    AGCU01093320    GEGO01005479    JAR89925.1    AGCU01055496    NSIT01000532    PJE77527.1    GEFM01006250    JAP69546.1    AAGJ04095885    AGCU01046616    AGCU01148809    AGCU01168427    LSMT01000588    PFX15986.1    GEGO01004061    JAR91343.1    AGCU01003726    AGCU01096477    GEGO01004497    JAR90907.1    AAGJ04079835    GFAC01007905    JAT91283.1    AGCU01135984    GEGO01004248    JAR91156.1    GEGO01002025    JAR93379.1    GEGO01003895    JAR91509.1    AGCU01111641    AGCU01156992    AGCU01018596    AGCU01190758    GEGO01004056    JAR91348.1    AGCU01143107    KZ505822    PKU44500.1    AGCU01064953   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF08159   NUC153
PF03372   Exo_endo_phos
PF01425   Amidase
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000120   Amidase       
IPR036928   AS_sf       
IPR023631   Amidase_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF50978   SSF50978       
SSF75304   SSF75304       
Gene 3D

Ontologies

Topology

Length:
329
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.71347
Exp number, first 60 AAs:
0.71344
Total prob of N-in:
0.04468
outside
1  -  329
 
 

Population Genetic Test Statistics

Pi
37.071416
Theta
51.646961
Tajima's D
-1.706621
CLR
1.147623
CSRT
0.0343982800859957
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号