SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02480  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA002575
Annotation
PREDICTED:_probable_peroxisomal_acyl-coenzyme_A_oxidase_1_[Amyelois_transitella]
Full name
Acyl-coenzyme A oxidase       + More
Transaldolase      
Location in the cell
Cytoplasmic   Reliability : 2.269
 

Sequence

CDS
ATGAGCAGCGTGAACCCTGATCTGGTCAAGGAGAGACAGAAATGTACCTTTGACGTACAGGAACTGGTGCATTTCATTGACAGAGGAGAGGAACACACCTTGGAGAGGAAAGAGTTGGAGGATTTGGTGCTTAGTGTCAAAGAGTTGAAGGATGAAACTCCCGAAGAATATTTAAGTCACAAAGAACGCTACGAGAACGCAATCCGAAAGGCCAGTTTATTGTTTAAAATTCTCCAGAAATATTTCGAGACGCACAACTTATTGGACATATTCAGTCCAACAAACAAGTACCGGGTGCAGTTCGGAGTCCTCAAGGATGTGTCACCGTTTTTGGTTCACATGGGCATGTTCCTGCCGACGCTCTTGCATCAAACCACTCCCGAACAAGCAGCCGAGTGGGTCCCTAAAGCGCAGAGCATGCAGATGATCGGCACTTATGCACAGACGGAGCTGGGTCACGGCACCTTCCTGAGAGGCTTGGAGACGACAGCAACTTACGACGCGAAAGCCGAAGAGTTTATACTGAACACTCCAACGCTGACTTCATTCAAATGGTGGCCCGGTGGATTGGCCCACACCGCCAACCACTGCGTTGTGGTAGCCCAACTATACACAAAAGGAAAGTGCTATGGTGTTCATCCGTTCCTCGTGCAAATTCGGGACTTGGAAACGCACATGCCGATGCCTGGTATCAAAATTGGCGAAATTGGATCGAAGCTTGGTTACAACACGGTCAACAATGGTTTCCTTGGCTTCAACAAAGTTAGAATACCGAGGACTAATCTTCTGATGAAGAATGCTCAAGTTCTGAAGGACGGGACTTATGTAAAAGCGAAAAGCGAGAAGTTGACTTATGGCACGATGGTATTGATACGCGTTCTGATTGTCACTGATATGGCGTACGAATTGGCCCGAGCGTCCACCGTCGCTGTCAGGTACTCGGTCGTCCGGCACCAGTCGCAACCGAAGCCGGGACAACCGGAGCCACAGATTATTGAATACGTGACTCAACAACATAAGTTGTTCATTGCTGTCGCTACGAGTCACGTTTACCGAATCACTGGGCACTGGCTCTGGGATACTTACTATAAGGTCACCAGCGATTTGGATAAAGGGAACCTTGAACAGTTGCCTGAACTCCACGCTGTCTCCTGTTGTCTCAAGGCGGTCTGCTCTCGAGACGCCTCAATCCACATCGACGATTGCAGGCTGGCTTGCGGTGGACACGGATACATGAAGTCTTCAAGCTTCCCTTTTATTCAGGCCATCGTAACGGCTAGTGTGACTTACGAAGGAGAATACACGGTTATGATGCTGCAGACTGCAAGATATCTTATGAAGACTTTAAAGCAAGCATTGTCTGGTAAAGCGATAACATCAACTGTGGCCTATCTGTTGGACTTTGACAAGAACAGTAATCGTAATTGGCAGAATACTCCCGAAGGCATCGTTATAGGGTTCCAGGCAATCGCAGCAGGATTAACAAAGGCAGCTTACGATGAAATAGAGAAACACGAAAAGACTGGATTAGATTACGAAGACTCTTGGAATCAGGCTTCCGTGCAACTTGTGAGAGCTAGTGAGGCACATTGCCGGGTGATTATCTGCGAGAAATCTTGGCTTGAAGCGCAGCGACTCACGAAATCGCTCTCCCCTGCTTTGTCGAAGGTGTTGCTGGAATTGGTTGAATTGTACATTATTTATTGGGCGTTGGAGAAAAAGGGAGACTTTCTAGTGTATACGAAAATGCAAAAGGATGACGTTATGCAACTACAGCAGAGATATGAAGAGTTGCTGGCAGTAATTCGACCTAACGCAGTCGGTTTAGTGGACGGCTTCGACATCAGAGACGAGATTCTGAACTCCACACTGGGGGCGTACGACGGGCGCGTGTACGAGCGCCTGATGGAGGAGGCGCTGAAGAGTCCTCTCAACGCGGAGCCCGTTAACACATCCTTCCACCAGTACCTCAAACCTTTCATGACTGCGAAACTGTAA
Protein
MSSVNPDLVKERQKCTFDVQELVHFIDRGEEHTLERKELEDLVLSVKELKDETPEEYLSHKERYENAIRKASLLFKILQKYFETHNLLDIFSPTNKYRVQFGVLKDVSPFLVHMGMFLPTLLHQTTPEQAAEWVPKAQSMQMIGTYAQTELGHGTFLRGLETTATYDAKAEEFILNTPTLTSFKWWPGGLAHTANHCVVVAQLYTKGKCYGVHPFLVQIRDLETHMPMPGIKIGEIGSKLGYNTVNNGFLGFNKVRIPRTNLLMKNAQVLKDGTYVKAKSEKLTYGTMVLIRVLIVTDMAYELARASTVAVRYSVVRHQSQPKPGQPEPQIIEYVTQQHKLFIAVATSHVYRITGHWLWDTYYKVTSDLDKGNLEQLPELHAVSCCLKAVCSRDASIHIDDCRLACGGHGYMKSSSFPFIQAIVTASVTYEGEYTVMMLQTARYLMKTLKQALSGKAITSTVAYLLDFDKNSNRNWQNTPEGIVIGFQAIAAGLTKAAYDEIEKHEKTGLDYEDSWNQASVQLVRASEAHCRVIICEKSWLEAQRLTKSLSPALSKVLLELVELYIIYWALEKKGDFLVYTKMQKDDVMQLQQRYEELLAVIRPNAVGLVDGFDIRDEILNSTLGAYDGRVYERLMEEALKSPLNAEPVNTSFHQYLKPFMTAKL

Summary

Description
Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Catalytic Activity
D-glyceraldehyde 3-phosphate + D-sedoheptulose 7-phosphate = beta-D-fructose 6-phosphate + D-erythrose 4-phosphate
Similarity
Belongs to the acyl-CoA oxidase family.
Feature
chain  Acyl-coenzyme A oxidase
EC Number
2.2.1.2
EMBL
BABH01014526    BABH01014527    NWSH01004519    PCG65001.1    ODYU01010838    SOQ56189.1    + More
KQ459465    KPJ00250.1    KZ150070    PZC74071.1    AGBW02014804    OWR41037.1    KPJ00249.1    KJ622089    AID66679.1    NWSH01004692    PCG64764.1    PCG65017.1    PZC74066.1    OWR41036.1    KPJ00253.1    BABH01014529    BABH01014530    BABH01014531    NEVH01026085    PNF14948.1    SOQ56188.1    BABH01014523    BABH01014524    BABH01014525    KPJ00248.1    KK852458    KDR23594.1    PCG65015.1    KPJ00251.1    KQ461103    KPJ09429.1    GFDF01002363    JAV11721.1    GL453255    EFN76281.1    GFDF01002362    JAV11722.1    KK107152    QOIP01000007    EZA57082.1    RLU20599.1    GL888087    EGI67733.1    GL437918    EFN69863.1    OWR41035.1    GEBQ01011024    JAT28953.1    BABH01014528    KQ978068    KYM97593.1    KJ622094    AID66684.1    KQ434892    KZC10515.1    GECZ01009098    JAS60671.1    KQ982603    KYQ53952.1    DS231921    EDS26532.1    PCG64763.1    GEDC01010765    JAS26533.1    GECU01023161    JAS84545.1    NNAY01001755    OXU23026.1    KZ288266    PBC30221.1    KX650075    ASR73781.1    AAZX01008228    KQ971307    EFA11530.1    DS235886    EEB20498.1    AJWK01017463    GBYB01004782    JAG74549.1    GFDL01008460    JAV26585.1    KQ414736    KOC62130.1    GFDL01008542    JAV26503.1    ATLV01023873    ATLV01023874    ATLV01023875    KE525347    KFB49756.1    GEZM01041563    JAV80282.1    AXCM01002223    GGFJ01002935    MBW52076.1    GGFJ01002932    MBW52073.1    ADMH02001629    ETN61710.1    GGFK01004406    MBW37727.1    CH477518    EAT39640.1    GFTR01007681    JAW08745.1    GBBI01000288    JAC18424.1    ODYU01009780    SOQ54435.1    GGFK01004608    MBW37929.1    GGFK01004495    MBW37816.1    GGFJ01002975    MBW52116.1    GGFJ01002974    MBW52115.1    GAPW01000427    JAC13171.1    GGFJ01002973    MBW52114.1    GGFM01007220    MBW27971.1    UFQS01000063    UFQT01000063    SSW98853.1    SSX19239.1    AXCM01002222    KQ979695    KYN19717.1    GGFM01007212    MBW27963.1    AAAB01008986    EAA00765.4    GL767232    EFZ13917.1    GECL01001862    JAP04262.1    ACPB03009151    AXCN02001109    APCN01002398    GANO01001544    JAB58327.1    GBHO01010451    JAG33153.1    ETN61709.1    JTDY01000978    KOB75219.1    ABLF02036307   
Pfam
PF14749   Acyl-CoA_ox_N        + More
PF01756   ACOX
PF02770   Acyl-CoA_dh_M
PF00441   Acyl-CoA_dh_1
PF00923   TAL_FSA
PF01480   PWI
Interpro
IPR029320   Acyl-CoA_ox_N        + More
IPR037069   AcylCoA_DH/ox_N_sf       
IPR036250   AcylCo_DH-like_C       
IPR002655   Acyl-CoA_oxidase_C       
IPR006091   Acyl-CoA_Oxase/DH_cen-dom       
IPR012258   Acyl-CoA_oxidase       
IPR009100   AcylCoA_DH/oxidase_NM_dom       
IPR009075   AcylCo_DH/oxidase_C       
IPR018225   Transaldolase_AS       
IPR013785   Aldolase_TIM       
IPR001585   TAL/FSA       
IPR004730   Transaldolase_1       
IPR036483   PWI_dom_sf       
IPR002483   PWI_dom       
SUPFAM
SSF56645   SSF56645        + More
SSF47203   SSF47203       
SSF101233   SSF101233       
Gene 3D
PDB
2DDH     E-value=5.17084e-166,     Score=1502

Ontologies

Topology

Length:
665
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.11056
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00146
outside
1  -  665
 
 

Population Genetic Test Statistics

Pi
290.926835
Theta
178.053438
Tajima's D
1.845012
CLR
0.346951
CSRT
0.856957152142393
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 IDQLAR 100.00 2e-05
28556443 ITAAWLWDK 100.00 0.002
28556443 GLETTATYDAK 100.00 0.002
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号