SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02343
Pre Gene Modal
BGIBMGA003570
Annotation
PREDICTED:_uncharacterized_protein_LOC106110672?_partial_[Papilio_polytes]
Location in the cell
Nuclear   Reliability : 2.97
 

Sequence

CDS
ATGGGAGATTTTAACGGTCAGATAGGAAAGCGCAATAACATTGGAGAAGAATACACTATAGAACTGTATGGCTCAGGCAAAATAACTAATAACGGAGAGAGATTAGTGACTTTTGCCTTACAACATAAACTCAGTATTCTTATAAGTTTTTTCAAAAAGAAGGAAAACAAAAAATGGACTTGGACATCCCCAAATGGCATTCATAAAAACGAAATCGATTTTGTCATGTCAAATAATCCTAAGTTTTTCAAGGATGTGTCAATTATCCACAACTTAAATTTCCACTCTGATCATAAAATGGTCCGTGCTGTATTGACTGGGAAACCTATGAAAAGGACAAGGAAGTATCATAACAATAATTCAAGGGTAGTGTGTACGGGAGAAAACGAAGCACTCTCAGCTAATCTCAAATTATTGGCAAAGAAACAACACTTGGATAAAGATTTATCCATTGAAGAAAAATACAATAAGTTCATACAAATATTAAAAGAAGCGACAAGAAAGACTAATACAGAAGATAATAGAGCGATTTCAAAACAAACACAGGAACTACTTCAAGAAAGGAAAAACCTCATTAAAGGAAAGGAGGATAAATATAAAATATCAGAAATTAGTAAGAAGATAAATGAACAAATTAGAAAAGATAGAAAAATTAAACGGAACAGCACTATGGAAAAACACATAGAGAAGACAGGTGGAATTAAAAAGGCTATAAAAGAACTAACAGTAAAAAAGGACTGGATGCCAAAAGTAAAGACTGACAAAAATAACTACACCTGTAAACGACCAGAAATACTGGAGTTGGCTACAGATTATTACAAGAAACTATATAAAAGCAACAAGAGTGGAAGAGCTCAAATAAATGAACTAGAATCTGTAGGAACTAATATCACACCTACAATTTTGACGGAGGAAACATGTATAGCTGCTGGTCGGTAA
Protein
MGDFNGQIGKRNNIGEEYTIELYGSGKITNNGERLVTFALQHKLSILISFFKKKENKKWTWTSPNGIHKNEIDFVMSNNPKFFKDVSIIHNLNFHSDHKMVRAVLTGKPMKRTRKYHNNNSRVVCTGENEALSANLKLLAKKQHLDKDLSIEEKYNKFIQILKEATRKTNTEDNRAISKQTQELLQERKNLIKGKEDKYKISEISKKINEQIRKDRKIKRNSTMEKHIEKTGGIKKAIKELTVKKDWMPKVKTDKNNYTCKRPEILELATDYYKKLYKSNKSGRAQINELESVGTNITPTILTEETCIAAGR

Summary

Cofactor
Fe(2+)
Similarity
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Belongs to the carotenoid oxygenase family.
EMBL
KZ150049    PZC74456.1    ODYU01001637    SOQ38140.1    FJ265564    ADI61832.1    + More
ODYU01013311    SOQ60019.1    JTDY01001738    KOB73037.1    JTDY01014306    KOB52041.1    FJ265563    ADI61831.1    FJ265561    ADI61829.1    NWSH01001447    PCG71212.1    FJ265562    ADI61830.1    ODYU01008249    SOQ51673.1    JTDY01006707    KOB65758.1    GBBI01004876    JAC13836.1    FJ265544    ADI61812.1    GEFH01000854    JAP67727.1    GBBM01003763    JAC31655.1    ACPB03015413    FJ265550    ADI61818.1    FJ265549    ADI61817.1    JARK01001676    JARK01001446    JARK01001433    EYB83199.1    EYC01126.1    EYC02928.1    JARK01001565    EYB89683.1    JARK01001337    EYC34625.1    JARK01001372    EYC15676.1    JTDY01000008    KOB79474.1    FJ265542    ADI61810.1    KZ149907    PZC78256.1    JTDY01000715    KOB76117.1    JTDY01002682    KOB70937.1    FJ265543    ADI61811.1    JTDY01000361    KOB77547.1    JARK01001351    EYC23458.1    JARK01001435    EYC02484.1    JARK01001424    EYC04321.1    GEDV01000266    JAP88291.1    GBGD01000380    JAC88509.1    GEDV01005625    JAP82932.1    JARK01001338    EYC33045.1    CAVP010052198    CDL93746.1    JARK01001354    EYC21713.1    JARK01000126    EYC42577.1    EYC21986.1    QFQQ01000179    PZR20596.1    ODYU01004088    SOQ43598.1    GBBI01004877    JAC13835.1    GBGD01000453    JAC88436.1    JARK01001345    EYC27376.1    JARK01001413    EYC06243.1    EYC27377.1    EYC06245.1    EYC06244.1    KZ345286    PIO74399.1    EYC06246.1    GDKW01001596    JAI54999.1    JARK01001655    EYB84321.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF03372   Exo_endo_phos
PF00153   Mito_carr
PF03055   RPE65
Interpro
IPR027124   Swc5/CFDP2        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR018108   Mitochondrial_sb/sol_carrier       
IPR023395   Mt_carrier_dom_sf       
IPR016186   C-type_lectin-like/link_sf       
IPR016187   CTDL_fold       
IPR004294   Carotenoid_Oase       
SUPFAM
SSF56219   SSF56219        + More
SSF103506   SSF103506       
SSF56436   SSF56436       
Gene 3D

Ontologies

Topology

Length:
312
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00681
Exp number, first 60 AAs:
0.00681
Total prob of N-in:
0.01545
outside
1  -  312
 
 

Population Genetic Test Statistics

Pi
2.75497
Theta
7.330723
Tajima's D
-1.756536
CLR
1.84507
CSRT
0.0277486125693715
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号