Gene

KWMTBOMO01999  Validated by peptides from experiments

Pre Gene Modal

BGIBMGA004307

Annotation

PREDICTED:_enhancer_of_yellow_2_transcription_factor-like_[Amyelois_transitella]

Location

Bomo_Chr4(+):9694473-9695804      View in EpiBrowser

Full name

Enhancer of yellow 2 transcription factor       + More
Transcription and mRNA export factor ENY2      

Alternative Name

Enhancer of yellow 2 transcription factor homolog

Location in the cell

Mitochondrial   Reliability : 1.592 Nuclear   Reliability : 1.947

CDS

ATGACTGTGAATAACACCATTGCACACCAACGTTTAATTCTTAGTGGAGATCGAGAAAGGTTTAAGGAGCTTTTGAGAAGGAGATTAATAGAATGTGGATGGAGAGATCAAGTCAGAATGCTATGTCGAGACATAGTGAAAGAAAATGAGAGCGGAAACATCACATTTGATTCTTTAGTAACAAAGGTGACTCCCCGTGCTAGAGCACTTGTGCCAGATTCAGTGAAAAAAGAATTATTGCAGAAAATTAAAACCCATCTACTCACACAGAAAGACCAATAA

Protein

MTVNNTIAHQRLILSGDRERFKELLRRRLIECGWRDQVRMLCRDIVKENESGNITFDSLVTKVTPRARALVPDSVKKELLQKIKTHLLTQKDQ

Description

Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates to a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.
Involved in mRNA export coupled transcription activation by association with both the AMEX and the SAGA complexes. The SAGA complex is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Involved in transcription elongation by recruiting the THO complex onto nascent mRNA. The AMEX complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). AMEX participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity).
Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity).
Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates to a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.
Involved in mRNA export coupled transcription activation by association with both the AMEX and the SAGA complexes. The SAGA complex is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates to a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Involved in transcription elongation by recruiting the THO complex onto nascent mRNA. The AMEX complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). AMEX participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.

Subunit

Component of the nuclear pore complex (NPC)-associated TREX-2 complex (transcription and export complex 2). Component of the SAGA transcription coactivator-HAT complex. Within the SAGA complex, participates to a subcomplex of SAGA called the DUB module (deubiquitination module).
Component of the nuclear pore complex (NPC)-associated AMEX complex (anchoring and mRNA export complex), composed of at least e(y)2 and xmas-2. Component of the SAGA transcription coactivator-HAT complexes, at least composed of Ada2b, e(y)2, Pcaf/Gcn5, Taf10 and Nipped-A/Trrap. Within the SAGA complex, e(y)2, Sgf11, and not/nonstop form an additional subcomplex of SAGA called the DUB module (deubiquitination module). Component of the THO complex, composed of at least e(y)2, HPR1, THO2, THOC5, THOC6 and THOC7. Interacts with e(y)1. Interacts with su(Hw) (via zinc fingers). Interacts with xmas-2; required for localization to the nuclear periphery. Interacts with the nuclear pore complex (NPC).
Component of the nuclear pore complex (NPC)-associated TREX-2 complex (transcription and export complex 2). Component of the SAGA transcription coactivator-HAT complex. Within the SAGA complex, participates in a subcomplex of SAGA called the DUB module (deubiquitination module) (By similarity).
Component of the nuclear pore complex (NPC)-associated TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. TREX-2 contains 2 ENY2 chains. The TREX-2 complex interacts with the nucleoporin NUP153. Component of some SAGA transcription coactivator-HAT complexes, at least composed of ATXN7, ATXN7L3, ENY2, GCN5L2, SUPT3H, TAF10, TRRAP and USP22. Within the SAGA complex, ENY2, ATXN7, ATXN7L3, and USP22 form an additional subcomplex of SAGA called the DUB module (deubiquitination module). Interacts directly with ATXN7L3, GANP and with the RNA polymerase II. Interacts strongly with ATXN7L3 and ATXN7L3B.

Similarity

Belongs to the ENY2 family.

Keywords

Activator   Chromatin regulator   Complete proteome   Cytoplasm   mRNA transport   Nuclear pore complex   Nucleus   Protein transport   Reference proteome   Transcription   Transcription regulation   Translocation   Transport  

Feature

chain  Enhancer of yellow 2 transcription factor

Uniprot

A0A2A4JZU5   A0A2A4K0Y0   A0A2H1WSA5   A0A194RBA0   A0A212ESZ9   I4DKX2   + More
S4NVK7   H9J468   A0A026WV43   F4WGD0   A0A158NI46   A0A2A3E8Y5   A0A088A320   A0A310SHK6   A0A0L7QXG2   A0A0M9A7G2   A0A0J7KHT3   A0A2P8YTI2   B3MQ24   A0A195CP71   A0A154P5B9   B4M6M6   A0A195F069   A0A067RKG9   A0A195EFZ5   E2AUI3   A0A151WJH2   A0A023EEE4   Q17MZ8   E2BV72   A0A232FDK3   K7J8Z4   T1ISW1   B4N1G8   A0A0L0BWC3   B4L1Z8   T1FHE2   A0A1I8MGG6   A0A1Q3F4P9   K4G0B6   A0A1B0FLE0   A0A1B0BSM9   A0A1A9Z3N5   A0A1Q3F471   F7G3F4   Q6DH42   A0A0P8YST3   A0A1B0EU97   B0WG73   A0A093IXG8   B4JLC3   C3ZZM0   A0A1Z5KXE8   F7C227   A0A091G502   A0A091FWX7   G3VFQ5   A0A2I0UU06   A0A3L8T0P2   A0A218VDK2   G1KYQ7   A0A0B8RRU7   U3JUD0   A0A0Q3XAL6   V8NTG8   A0A2I0MWF1   A0A098LYV6   B5FZ63   A0A091HE87   A0A093Q831   A0A091HPW1   A0A091UKD0   A0A091J791   A0A099ZYG2   A0A091QWC4   A0A093NBA4   A0A091SII3   A0A087R772   H0ZPT2   A0A091R1S9   A0A099ZVZ9   A0A093H7H5   A0A091VFN9   A0A1V4KH29   A0A087VBV9   A0A1I8PE17   A0A1B1JCE7   A0A3N0XS03   K7FHN5   A0A094K7S1   A0A1D5PYW8   U5EXI7   R0LHK8   A0A1S3IAJ2   A0A1W5AZL6   H3AXA7   Q29IN4   A0A1L8FZW0   Q3KPT5  

Pubmed

26354079    22118469    22651552    23622113    19121390    24508170    + More
30249741    21719571    21347285    29403074    17994087    24845553    20798317    24945155    26483478    17510324    28648823    20075255    26108605    23254933    25315136    23056606    18464734    18563158    28528879    17495919    21709235    30282656    25476704    24297900    23371554    17018643    20360741    18574105    17381049    15592404    9215903    15632085    27762356   

EMBL

NWSH01000331    PCG77329.1    PCG77330.1    ODYU01010684    SOQ55959.1    KQ460398    + More
KPJ15103.1    AGBW02012699    OWR44599.1    AK401940    KQ459601    BAM18562.1    KPI93789.1    GAIX01012912    JAA79648.1    BABH01032542    KK107111    QOIP01000011    EZA58974.1    RLU17169.1    GL888128    EGI66897.1    ADTU01016271    KZ288322    PBC28185.1    KQ761039    OAD58350.1    KQ414704    KOC63295.1    KQ435719    KOX78767.1    LBMM01007353    KMQ89812.1    PYGN01000369    PSN47545.1    CH902621    KQ977481    KYN02440.1    KQ434809    KZC06378.1    CH940653    KQ981897    KYN33751.1    KK852415    KDR24366.1    KQ978957    KYN27086.1    GL442821    EFN62909.1    KQ983039    KYQ48008.1    JXUM01049131    JXUM01132269    GAPW01006594    GAPW01006593    KQ567821    KQ561591    JAC07005.1    KXJ69262.1    KXJ78081.1    CH477203    GL450824    EFN80364.1    NNAY01000412    OXU28590.1    JH431448    CH963925    JRES01001243    KNC24323.1    CH933810    AMQM01007834    KB097673    ESN92064.1    GFDL01012587    JAV22458.1    JX052753    AFK10981.1    CCAG010010324    JXJN01019798    GFDL01012691    JAV22354.1    AAPN01402473    BC076140    KPU81606.1    AJWK01014147    DS231923    KL216808    KFV71341.1    CH916370    GG666758    EEN42010.1    GFJQ02007265    JAV99704.1    KL447782    KFO77008.1    KK719751    KFO65880.1    AEFK01066052    KZ505636    PKU49541.1    QUSF01000001    RLW13267.1    MUZQ01000006    OWK64043.1    GBSH01000970    JAG68055.1    AGTO01010677    LMAW01000115    KQL60588.1    AZIM01002083    ETE64842.1    AKCR02000001    PKK34003.1    GBSI01000824    JAC95672.1    DQ214330    KL534109    KFO93784.1    KL670890    KFW80357.1    KL217684    KFO97876.1    KL409711    KFQ91359.1    KK501492    KFP15595.1    KL870020    KGL86747.1    KK683590    KFQ13649.1    KL224593    KFW61466.1    KK473128    KFQ58148.1    KL226153    KFM09326.1    ABQF01006042    KK710805    KFQ33194.1    KL897924    KGL84965.1    KL205974    KFV77626.1    KK733943    KFR01570.1    LSYS01003169    OPJ83776.1    KL487555    KFO10101.1    KU359107    ANS11586.1    RJVU01062584    ROJ29348.1    AGCU01085412    AGCU01085413    KL344018    KFZ54684.1    AADN05000663    GANO01000932    JAB58939.1    KB743132    EOB01110.1    AFYH01148797    AFYH01148798    AFYH01148799    AFYH01148800    CH379063    CM004476    OCT77097.1    BC106564   

Proteomes

UP000218220    UP000053240    UP000007151    UP000053268    UP000005204    UP000053097    + More
UP000279307    UP000007755    UP000005205    UP000242457    UP000005203    UP000053825    UP000053105    UP000036403    UP000245037    UP000007801    UP000078542    UP000076502    UP000008792    UP000078541    UP000027135    UP000078492    UP000000311    UP000075809    UP000069940    UP000249989    UP000008820    UP000008237    UP000215335    UP000002358    UP000007798    UP000037069    UP000009192    UP000015101    UP000095301    UP000092444    UP000092460    UP000092445    UP000002279    UP000000437    UP000092461    UP000002320    UP000053875    UP000001070    UP000001554    UP000002280    UP000053760    UP000052976    UP000007648    UP000276834    UP000197619    UP000001646    UP000016665    UP000051836    UP000053872    UP000007754    UP000053258    UP000054308    UP000053283    UP000053119    UP000053858    UP000054081    UP000053286    UP000053641    UP000053584    UP000053605    UP000190648    UP000095300    UP000007267    UP000000539    UP000085678    UP000192224    UP000008672    UP000001819    UP000186698   

PRIDE

H9J468    B3MQ24   

Pfam

PF10163   EnY2        + More
PF00240   ubiquitin

Interpro

IPR018783   TF_ENY2        + More
IPR038212   TF_EnY2_sf       
IPR019954   Ubiquitin_CS       
IPR019956   Ubiquitin       
IPR000626   Ubiquitin_dom       
IPR029071   Ubiquitin-like_domsf       

SUPFAM

SSF54236   SSF54236       

Gene 3D

1.10.246.140    

ProteinModelPortal

A0A2A4JZU5   A0A2A4K0Y0   A0A2H1WSA5   A0A194RBA0   A0A212ESZ9   I4DKX2   + More
S4NVK7   H9J468   A0A026WV43   F4WGD0   A0A158NI46   A0A2A3E8Y5   A0A088A320   A0A310SHK6   A0A0L7QXG2   A0A0M9A7G2   A0A0J7KHT3   A0A2P8YTI2   B3MQ24   A0A195CP71   A0A154P5B9   B4M6M6   A0A195F069   A0A067RKG9   A0A195EFZ5   E2AUI3   A0A151WJH2   A0A023EEE4   Q17MZ8   E2BV72   A0A232FDK3   K7J8Z4   T1ISW1   B4N1G8   A0A0L0BWC3   B4L1Z8   T1FHE2   A0A1I8MGG6   A0A1Q3F4P9   K4G0B6   A0A1B0FLE0   A0A1B0BSM9   A0A1A9Z3N5   A0A1Q3F471   F7G3F4   Q6DH42   A0A0P8YST3   A0A1B0EU97   B0WG73   A0A093IXG8   B4JLC3   C3ZZM0   A0A1Z5KXE8   F7C227   A0A091G502   A0A091FWX7   G3VFQ5   A0A2I0UU06   A0A3L8T0P2   A0A218VDK2   G1KYQ7   A0A0B8RRU7   U3JUD0   A0A0Q3XAL6   V8NTG8   A0A2I0MWF1   A0A098LYV6   B5FZ63   A0A091HE87   A0A093Q831   A0A091HPW1   A0A091UKD0   A0A091J791   A0A099ZYG2   A0A091QWC4   A0A093NBA4   A0A091SII3   A0A087R772   H0ZPT2   A0A091R1S9   A0A099ZVZ9   A0A093H7H5   A0A091VFN9   A0A1V4KH29   A0A087VBV9   A0A1I8PE17   A0A1B1JCE7   A0A3N0XS03   K7FHN5   A0A094K7S1   A0A1D5PYW8   U5EXI7   R0LHK8   A0A1S3IAJ2   A0A1W5AZL6   H3AXA7   Q29IN4   A0A1L8FZW0   Q3KPT5  

PDB

4DHX     E-value=1.70144e-13,     Score=177

KEGG

101737857    K11368 enhancer of yellow 2 transcription factor | (RefSeq) transcription and mRNA export factor ENY

GO

GO:0071819   GO:0006406   GO:0000124   GO:0006368   GO:0005643   GO:0003713   GO:0045893   GO:0016578   GO:0070390   GO:0034399   GO:0070742   GO:0001094   GO:0043035   GO:0016973   GO:0045944   GO:0005737   GO:0031936   GO:0000785   GO:0030374   GO:0016021   GO:0006357   GO:0003682   GO:0044615   GO:0005739   GO:0016876   GO:0043039   GO:0004651   GO:0005634  

PANTHER

PTHR12514  

Subcellular location

Nucleus  
Nucleoplasm  
Nuclear pore complex  
Cytoplasm  

Length:

93

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0

Exp number, first 60 AAs:

0

Total prob of N-in:

0.62196

inside

1  -  93

 

 

Pi

435.569125

Theta

221.671891

Tajima's D

3.061713

CLR

0

CSRT

0.981150942452877

Interpretation

Uncertain